Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017143080            1010 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108058387), mRNA.
ACCESSION   XM_017143080
VERSION     XM_017143080.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143080.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1010
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1010
                     /gene="LOC108058387"
                     /note="uncharacterized LOC108058387; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108058387"
     CDS             1..927
                     /gene="LOC108058387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016998569.2"
                     /db_xref="GeneID:108058387"
                     /translation="MSENKVWMGCWMPLLLLLTTATCICANPGSFEDLEARDSSVVVD
                     TSSSSSAGMLNDPTQPKHMSFQRPPMAYKDYRDYKDYDYILGPPPPRRMANGDSYAAA
                     DNDLSATSALKIHGEGNLASLNRPVVQKPLPWYGDYSGKLLANAPMYPSRSYDPYIRR
                     YDRFDEQYHRNYPQYFEDMYMHRQRFDPYDSYSPRIPQYPDPYIMYPDRYPDYPKMRR
                     GYIDEQPIMDSYSSSKFGGSSKPADLTTFPARNERIVYYAHLPEIVRTPYDSAPPEDR
                     NSAPYKLNKKLKLKSNLRPLANNNTTTYKMTL"
ORIGIN      
        1 atgtcggaga ataaagtgtg gatgggctgt tggatgccgc tgctgctcct gttgaccaca
       61 gccacctgca tttgtgcaaa ccctggtagt ttcgaggatt tggaggcgag ggacagcagt
      121 gtggtggtgg acacgtcgtc atcctcgtcg gcgggaatgc tgaatgaccc aacgcagccc
      181 aagcacatga gtttccagag gcctcccatg gcctacaagg actacaggga ctacaaggac
      241 tacgactaca tcctgggtcc tcctcctcca cggcgaatgg ccaatggcga ttcctatgct
      301 gcggcggaca acgatctcag tgccacatcc gctttgaaga ttcacggcga aggcaacttg
      361 gcctcgctca acaggccggt tgtccagaaa ccactgccct ggtacggcga ctactccggc
      421 aaactgctgg ccaatgctcc catgtatccc tcacggtcct acgatcccta catccgacga
      481 tacgacagat tcgatgagca ataccatcgc aactatccgc agtacttcga ggacatgtac
      541 atgcaccggc agcgcttcga tccgtacgat agctacagtc cgcggattcc gcagtatccg
      601 gatccgtaca ttatgtatcc cgatcgctac ccggactatc cgaaaatgcg tcgtggctat
      661 atcgatgagc aacccataat ggattcctac agcagcagca agttcggcgg ctcttcgaag
      721 ccagccgatc tgacgacttt tccggcccga aacgagcgga tcgtctacta tgcccacctg
      781 cccgagatcg tgcgcactcc atatgacagt gcgccgccgg aggatcggaa ctctgctccc
      841 tacaagctga ataaaaagct aaaactaaag tccaatctgc gacctctagc gaataataat
      901 accaccacct ataagatgac cttgtagacg agtattgttt agcaactaag atattttttt
      961 ttaatattca ttactcaaaa gcatttgtat ctgccacccc atggagctaa