Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017143080 1010 bp mRNA linear INV 09-DEC-2024 (LOC108058387), mRNA. ACCESSION XM_017143080 VERSION XM_017143080.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017143080.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1010 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1010 /gene="LOC108058387" /note="uncharacterized LOC108058387; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108058387" CDS 1..927 /gene="LOC108058387" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016998569.2" /db_xref="GeneID:108058387" /translation="MSENKVWMGCWMPLLLLLTTATCICANPGSFEDLEARDSSVVVD TSSSSSAGMLNDPTQPKHMSFQRPPMAYKDYRDYKDYDYILGPPPPRRMANGDSYAAA DNDLSATSALKIHGEGNLASLNRPVVQKPLPWYGDYSGKLLANAPMYPSRSYDPYIRR YDRFDEQYHRNYPQYFEDMYMHRQRFDPYDSYSPRIPQYPDPYIMYPDRYPDYPKMRR GYIDEQPIMDSYSSSKFGGSSKPADLTTFPARNERIVYYAHLPEIVRTPYDSAPPEDR NSAPYKLNKKLKLKSNLRPLANNNTTTYKMTL" ORIGIN 1 atgtcggaga ataaagtgtg gatgggctgt tggatgccgc tgctgctcct gttgaccaca 61 gccacctgca tttgtgcaaa ccctggtagt ttcgaggatt tggaggcgag ggacagcagt 121 gtggtggtgg acacgtcgtc atcctcgtcg gcgggaatgc tgaatgaccc aacgcagccc 181 aagcacatga gtttccagag gcctcccatg gcctacaagg actacaggga ctacaaggac 241 tacgactaca tcctgggtcc tcctcctcca cggcgaatgg ccaatggcga ttcctatgct 301 gcggcggaca acgatctcag tgccacatcc gctttgaaga ttcacggcga aggcaacttg 361 gcctcgctca acaggccggt tgtccagaaa ccactgccct ggtacggcga ctactccggc 421 aaactgctgg ccaatgctcc catgtatccc tcacggtcct acgatcccta catccgacga 481 tacgacagat tcgatgagca ataccatcgc aactatccgc agtacttcga ggacatgtac 541 atgcaccggc agcgcttcga tccgtacgat agctacagtc cgcggattcc gcagtatccg 601 gatccgtaca ttatgtatcc cgatcgctac ccggactatc cgaaaatgcg tcgtggctat 661 atcgatgagc aacccataat ggattcctac agcagcagca agttcggcgg ctcttcgaag 721 ccagccgatc tgacgacttt tccggcccga aacgagcgga tcgtctacta tgcccacctg 781 cccgagatcg tgcgcactcc atatgacagt gcgccgccgg aggatcggaa ctctgctccc 841 tacaagctga ataaaaagct aaaactaaag tccaatctgc gacctctagc gaataataat 901 accaccacct ataagatgac cttgtagacg agtattgttt agcaactaag atattttttt 961 ttaatattca ttactcaaaa gcatttgtat ctgccacccc atggagctaa