Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii defective proboscis extension


LOCUS       XM_017143073            2487 bp    mRNA    linear   INV 09-DEC-2024
            response 18 (dpr18), mRNA.
ACCESSION   XM_017143073
VERSION     XM_017143073.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143073.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2487
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2487
                     /gene="dpr18"
                     /note="defective proboscis extension response 18; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108058380"
     CDS             346..1902
                     /gene="dpr18"
                     /codon_start=1
                     /product="uncharacterized protein dpr18"
                     /protein_id="XP_016998562.2"
                     /db_xref="GeneID:108058380"
                     /translation="MRLSKGYRTLSPASNAAQTLPLSYKSQTSLSLLRLLAIVLVLGP
                     QVHVLCSASVEPKTPSTSTQPRIGENRTLLFDDYNKNKTILSTADYQSATRATLYAYS
                     SQDQDQDQYQSQMPSAIPTKMSRDKAIIGGTPGSGVEISDSHPIKNVGTTDQLTTVTM
                     PTTAFESLKTDKSTIKQPIDSTRTRNHWTASGFARVTERPRSKHHHEHHWGPFFEEPI
                     NSPTSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPR
                     IRVKFQYPNNWRLLINPTQTEDAGVYMCQVSTHPPRVFTTNLTILEPPLRIIDEHERD
                     VGDRYYKSGSTVDLQCQISRSFFQKERQAILKSSTDSANDAVQKLFNETNSELNLING
                     NSSQLPPHKFSGQDLEKYFTKFITWAKDEEPLQGMTNKRLSVSDVWLTSRISIGDAKL
                     SDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQHNIASRPQICSLALLGLLIKLIFLFT
                     CLKTDESRIF"
     misc_feature    1054..1305
                     /gene="dpr18"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     misc_feature    1054..1068
                     /gene="dpr18"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409433"
     misc_feature    1093..1122
                     /gene="dpr18"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409433"
     misc_feature    1204..1218
                     /gene="dpr18"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409433"
     misc_feature    1246..1263
                     /gene="dpr18"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409433"
     misc_feature    <1588..1761
                     /gene="dpr18"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:472250"
ORIGIN      
        1 gatgcctggg attgagtaat atattttttt aaatattttt ttttgttcct tgcaaaaccg
       61 aatgcaaagg tgccaaagtg tttgtttaaa tgtgccatgt gctaactaat caagtgattt
      121 tctaatcgct gcaatttcca actcctgcga ccttgaatgg tagtcaaaac aacacaacat
      181 cgctgcacat gtttaaatct aaatgttaaa gaaaaaaggg aaaaatttga tcggctatcg
      241 acaagattca gtgccagaaa gcagctgagt ttttcgcgaa actaagatga aggttactga
      301 tttctctcga gcacattccg taagtcacgt cgccccgtgc aaaggatgag gctttcaaaa
      361 ggatatagga cattatcacc agcatcgaac gctgcccaga cattgccact ctcctacaaa
      421 tcacaaacca gtctgagcct ccttcggctg ctcgcaattg tcttggtgct tggaccgcaa
      481 gttcatgttc tatgctcagc atccgtcgaa ccaaaaaccc cctcgacaag tacacaaccc
      541 agaatcggcg agaatcgtac tttacttttt gatgactata ataaaaataa gacgatatta
      601 tcaactgctg actaccagtc agccacaaga gccacccttt acgcatattc atcgcaggac
      661 caggaccagg atcagtacca gtcccaaatg ccaagcgcca ttcccacaaa aatgagcagg
      721 gataaagcaa tcattggggg gacaccgggc agcggtgtgg agattagcga tagccatcca
      781 atcaaaaatg ttggtacaac tgatcagcta acgacagtta cgatgccgac aacagcgttt
      841 gagtccctga aaaccgataa gagtacgata aaacagccaa tcgattccac ccgcacgaga
      901 aatcattgga cagcgagtgg attcgcccgt gtcacagaac gaccacgaag taagcaccac
      961 catgagcacc actggggacc cttttttgag gagcccataa actcgccaac ttcgggagac
     1021 aatctcgtgt ccgccgtgca tttgttcacg gaggctgtgc tcaactgtcg tgtcggtatg
     1081 ctcaaggaca aaaccgtcat gtgggtcagg cgaacggccg aaaaggtatc actcctgact
     1141 gttggcaacg tgacctacag tggagacccg aggattcggg tgaagttcca gtacccgaac
     1201 aactggcgat tacttatcaa cccaacgcag actgaagatg ccggagttta catgtgccag
     1261 gtttccaccc atccaccccg ggtattcacc acaaacctca ccatcttgga accgcctcta
     1321 aggataattg atgagcacga gcgggatgtc ggggatcgtt attataagtc aggcagcacc
     1381 gtcgatctgc aatgccaaat atctcgtagc tttttccaaa aggaacgtca agccattctt
     1441 aaatcatcaa cggattctgc aaatgatgct gtacaaaaac tgtttaatga gacaaatagt
     1501 gagcttaatt taatcaacgg caactcaagt cagttgccgc cgcataaatt ctctggccag
     1561 gatctggaaa agtactttac caagtttata acctgggcaa aagatgaaga gccactccaa
     1621 gggatgacca ataaacgctt aagtgtttcc gacgtatggc taaccagtcg tatctccatt
     1681 ggggatgcca aactctccga tagtggaaac tattcctgtt ctcttggccg actcttcacc
     1741 gtaattgtcc aagttcaagt gctcacaggg gaactacccg cagctgtcca gcacaatata
     1801 gcatcaaggc cccaaatctg ctccctggca ctattgggac ttctcatcaa actcattttc
     1861 ctcttcactt gcctaaaaac tgatgaaagt cgaatattct gaggcatatt aatctgacga
     1921 ttttcacaaa caattaacca atataatatt aaggataaag aaaaagaaat tggctggttc
     1981 taaacagaag gttttagttt taatgtttag aatcagaatg gtgatttcat tacatatttg
     2041 tgttatagtg cctacggtgt aataagactt caggttttgg ttttgacaaa tattcttaaa
     2101 attttgttaa aattgaaatt cggtaattgg aattaattag gcaacaagta cggaaacaat
     2161 aacattccaa attctaatga aaaaaccgat ttaaaacggt ttaaaaaaat tcaaatgtca
     2221 aacttttgtt ctagttaatt tagtaatctc ttaaagagtt aaggaactgg caaggaaatg
     2281 tttaatttac ctttctgcga cgacttaaag ctgatgaaaa ttagtatatt tatgattatt
     2341 ttattccttc aaccactttt gcaggcaaat caaatgtatc atacgctatt ttttgtgttt
     2401 tgtaccacta gttcacagga taacaagttt tttcaagaaa acaacaacga tctgattaaa
     2461 accttatgcg gtatactact ttttcat