Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii proteasome alpha4 subunit


LOCUS       XM_017143071            1159 bp    mRNA    linear   INV 09-DEC-2024
            (Prosalpha4), mRNA.
ACCESSION   XM_017143071
VERSION     XM_017143071.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017143071.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1159
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1159
                     /gene="Prosalpha4"
                     /note="proteasome alpha4 subunit; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:108058378"
     CDS             115..864
                     /gene="Prosalpha4"
                     /codon_start=1
                     /product="proteasome subunit alpha type-7-1"
                     /protein_id="XP_016998560.1"
                     /db_xref="GeneID:108058378"
                     /translation="MSSRYDRAVTIFSPDGHLLQVEYAQEAVRKGSTAVGVRGANCVV
                     LGVEKKSVAKLQEDRTVRKICMLDHHVVMAFAGLTADARILINRAQVECQSHRLNVED
                     PVTLEYITRYIAQLKQKYTQSNGRRPFGISCLIGGFDADGSAHLFQTEPSGIFYEYKA
                     NATGRSAKVVREFFEKAYKEEDVATERGAVKLAIRALLEVAQSGQNNLEVAIMENGMP
                     LKMLDSKVIAEYVKIIEKEKEEELEKKKQKK"
     misc_feature    127..753
                     /gene="Prosalpha4"
                     /note="The 20S proteasome, multisubunit proteolytic
                     complex, is the central enzyme of nonlysosomal protein
                     degradation in both the cytosol and nucleus. It is
                     composed of 28 subunits arranged as four homoheptameric
                     rings that stack on top of one another forming...; Region:
                     proteasome_alpha_type_7; cd03755"
                     /db_xref="CDD:239724"
     misc_feature    order(133..144,148..153,157..162,172..174,181..183,
                     190..195,202..204,226..228,271..273,277..282,349..357,
                     361..366,457..459,466..468,475..480,487..501,553..555,
                     568..573,577..579,583..588,592..594)
                     /gene="Prosalpha4"
                     /note="alpha subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239724"
     misc_feature    order(208..210,256..258,262..264,301..303,607..609)
                     /gene="Prosalpha4"
                     /note="active site"
                     /db_xref="CDD:239724"
     polyA_site      1159
                     /gene="Prosalpha4"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acacccggca ttgcctcaaa aaagcatcat cattgcctgc gctgcgaaga ctgaaaggga
       61 gccgaaaagc taaagtattc cgccaatacc tctgctgttg aaccgaacgc aaagatgtcc
      121 tcgcgctacg atcgagctgt aaccatattc tcgccggacg gccacctcct gcaggtcgag
      181 tacgcccagg aggccgttcg caagggatcc acagcggttg gagtacgcgg cgccaactgc
      241 gtggtcctcg gcgtggagaa gaagtcggtg gccaagctgc aggaggatcg cacggtgcgc
      301 aagatctgca tgctcgacca ccacgttgtg atggcctttg ccggcctcac cgccgatgcc
      361 cgcatcctca taaatcgcgc ccaggtggag tgccagagcc atcgcctgaa tgtcgaggat
      421 ccggtgaccc tcgagtacat aaccagatac attgcccagc tgaagcaaaa gtacacgcag
      481 agcaatggcc gccgtccctt tggcatttcc tgcctgatcg gcggcttcga tgccgatggc
      541 tctgcccacc tcttccagac cgaaccgtcc ggcattttct acgagtacaa ggccaacgcc
      601 accggccgtt cggcgaaggt ggtgcgcgag ttcttcgaga aggcctacaa ggaggaggac
      661 gtggccaccg agcgcggcgc cgtcaagctg gccattcgcg ccctcctgga ggtcgcccag
      721 tccggtcaga acaatctcga ggtggccatc atggagaacg gcatgccgct gaagatgctg
      781 gacagcaagg tgattgccga gtacgttaag atcatcgaga aggagaagga ggaggagctc
      841 gagaagaaga aacagaagaa gtaacatcca gcgcttcttc tgcggtggaa ggccttcgct
      901 ttgaaatgtt ttccaagtcg atccggcgac acaattgtat ttgggttgcc cacacattat
      961 gtctgctcag ggcggcagat cgagatcgag tcttggaaaa cgcttcaaat cccagcttcg
     1021 gttgcccgaa tgcactcgct tttttttaat tacccctttt ctattcttcg aaactttgta
     1081 taacggtatg aaactaattg atttgtataa aatacatgcg tcatcataca ttaaacggaa
     1141 tttctgttgg acccttgaa