Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein F54F2.9


LOCUS       XM_017142782            1906 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108058190), mRNA.
ACCESSION   XM_017142782
VERSION     XM_017142782.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142782.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1906
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1906
                     /gene="LOC108058190"
                     /note="uncharacterized protein F54F2.9; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108058190"
     CDS             73..1659
                     /gene="LOC108058190"
                     /codon_start=1
                     /product="uncharacterized protein F54F2.9"
                     /protein_id="XP_016998271.2"
                     /db_xref="GeneID:108058190"
                     /translation="MTRLDSLCMLLLLLLGALGGARAWHSEELEIFDLVEEVNRNFYE
                     FMGINQTATGAEVKRAFRTLSIVLHPDKNAAEDANIQFRNLVSIYEVLKDPSRREKYD
                     RVLKEGMPNWKSALYYYRRMRKIGLYEGAFILFLITTVGQYLFAWAAYLEKKYTAEQV
                     FGTKLKKLQKKNKNIDMDVILSEIPMPSLLNTLPIQIPLALWNLPRTIKNGFSKANEL
                     KELALEKRRQELEAARRQEELEREAEEQARLRKEHKENLRKRKQNSKAPEKTEEELRG
                     YSQIQAREMTDDDAVRPASQKSTVSGGFWTDEDLTELIRLVKKYPGGAGSRWNTIAES
                     MNRSVQEVTFMAAKMKENGYRIPGQTDSVAENLVQESQQAQRKEKVKKSASTAAAAPA
                     ASAGAPAEKSMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKSKEECL
                     VRYKYLCELVKTQKRAEEEANEQDEVEEEVLPEAEAEEEPLAEAAPAAKKLSKREQRR
                     RKRDLSSGEDSDDAYQYEIS"
     misc_feature    193..378
                     /gene="LOC108058190"
                     /note="DnaJ domain; Region: DnaJ; pfam00226"
                     /db_xref="CDD:395170"
     misc_feature    order(277..285,307..309,316..321,328..333)
                     /gene="LOC108058190"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     misc_feature    985..1098
                     /gene="LOC108058190"
                     /note="'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains.
                     Tandem copies of the domain bind telomeric DNA tandem
                     repeatsas part of the capping complex. Binding is sequence
                     dependent for repeats which contain the G/C rich motif
                     [C2-3 A (CA)1-6]. The domain is...; Region: SANT; cd00167"
                     /db_xref="CDD:238096"
     misc_feature    1297..1440
                     /gene="LOC108058190"
                     /note="'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains.
                     Tandem copies of the domain bind telomeric DNA tandem
                     repeatsas part of the capping complex. Binding is sequence
                     dependent for repeats which contain the G/C rich motif
                     [C2-3 A (CA)1-6]. The domain is...; Region: SANT; cd00167"
                     /db_xref="CDD:238096"
     misc_feature    order(1300..1302,1402..1407,1411..1416,1420..1428,
                     1432..1440)
                     /gene="LOC108058190"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238096"
     polyA_site      1906
                     /gene="LOC108058190"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtgttcgtg tggtgcgtgc gtgtctgccg cattaaattt ggatttggaa ttggattctc
       61 gacaggatct cgatgacgcg actggacagc ctctgcatgc tgctgctgct gctgctgggc
      121 gccctgggcg gtgcccgcgc ctggcactcg gaggagctgg agatcttcga tttggtcgag
      181 gaggtgaacc gcaacttcta cgagttcatg ggcatcaacc aaacggccac gggcgccgag
      241 gtgaagcgcg cctttcgcac cctctccatc gttctgcatc cggacaagaa tgccgccgag
      301 gacgccaaca tccagttccg caacctggtt tccatctacg aggtgctcaa ggatccttcg
      361 cggcgggaga agtacgaccg ggtgctcaag gagggcatgc ccaattggaa atcggcgctc
      421 tactactacc gccgcatgcg gaagatcggg ctctacgagg gcgccttcat cctcttcctg
      481 atcaccaccg tgggccagta tctgttcgcc tgggccgcct atctcgagaa gaagtacacc
      541 gccgagcagg tgttcggcac caagctgaag aagctgcaga agaagaacaa gaacatcgac
      601 atggatgtga tcctcagcga gatacccatg ccctcgctcc tgaacaccct gcccatccag
      661 atcccgctgg cgctgtggaa cctgccgcga acgatcaaga acggcttcag caaggccaac
      721 gagctcaagg aactggcgct ggagaagcgc aggcaggaac tggaggccgc ccgtcgccag
      781 gaggaactgg agcgcgaggc cgaggagcag gcgcgcctgc gcaaggagca caaggagaac
      841 ctacgcaagc gcaagcagaa cagcaaggcg cccgagaaga ccgaggagga gttgcgcggc
      901 tactcgcaga ttcaggcgcg tgaaatgacc gatgacgatg cagttcgtcc agcttcccag
      961 aagagcaccg tgagcggcgg cttctggact gacgaggatc tcaccgagct gattcgactg
     1021 gtgaagaagt acccaggcgg ggcgggcagt cgctggaaca ccattgccga atcgatgaat
     1081 cgcagcgttc aggaggtcac cttcatggcg gccaagatga aggagaacgg ctaccgcatt
     1141 cccggccaaa cggacagcgt ggccgagaat ctcgtccagg agtcccagca ggcgcagcgc
     1201 aaggagaagg tcaagaagtc ggcttctacg gcggcggcag ctcctgccgc ttcggccggc
     1261 gctcccgcag agaagagcat gctcataccg gagaccaact ggacgcagga gcagcagcgc
     1321 gccctggagg cggcgattgt caagtaccgg aagaccgccg gcggcgatcg ttggcagaag
     1381 atcgccaaca gtgtgccgga gaagagcaag gaggagtgcc tggtgcgcta caagtatctc
     1441 tgcgagctgg tcaagacaca gaagcgggcc gaggaggagg ccaacgagca ggatgaggtg
     1501 gaggaggagg tgctgccgga ggcggaggcg gaggaggagc ccctagcgga agcggcgccg
     1561 gccgccaaga agctttcgaa gcgggagcag cggcgacgca aacgggactt gtccagcggc
     1621 gaggattcag acgatgcgta tcagtacgag atcagttagt cagttggtca ggtgatccca
     1681 agtcctcctg cctcggcagc tcctcctcgc acggctcaaa cctagatgta attgaatttt
     1741 ttttatactt tgcattaaag actctctggc atgatccggc catatacctt tccgtagccc
     1801 cctttgtgta gcgcttatct tatgttttgt acataattct atcttgtaat aatctaaatg
     1861 tcgattaatt cccttgctaa gtaaacgaaa tgtggaagga agtgga