Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii protein-lysine N-methyltransferase


LOCUS       XM_017142781            1125 bp    mRNA    linear   INV 09-DEC-2024
            EEF2KMT (LOC108058189), mRNA.
ACCESSION   XM_017142781
VERSION     XM_017142781.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142781.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1125
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1125
                     /gene="LOC108058189"
                     /note="protein-lysine N-methyltransferase EEF2KMT; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108058189"
     CDS             114..1079
                     /gene="LOC108058189"
                     /codon_start=1
                     /product="protein-lysine N-methyltransferase EEF2KMT"
                     /protein_id="XP_016998270.2"
                     /db_xref="GeneID:108058189"
                     /translation="MSGKYEKLQQQFLCCYPVNKMAWSSVAFPLSWEDQQELIAATCG
                     HPLNRRFPVRRSYLEAFLKQLMHLLRDQEDVHDDIYSSLCGPMGEKASTGSVTPSAYA
                     YKHYLIEPGAHITLRESRSFVAEGTTGLCTWEAALALGDYLLQHRDLVAGRNIVELGA
                     GAGLLGVLLKLPALQLKTGQVLLTDGSEPCVQLMRENIALNFRDGPREAMPQAEQLNW
                     DAVSEFPWHAHPEPDLLLAADVIYDDSQFDALLSALDFLYTRRGKGLETLLASTVRNV
                     DTLHKFMTQLGDNNYKVTPCANVSACASHFCRDHTAAVQIISIRR"
     misc_feature    135..362
                     /gene="LOC108058189"
                     /note="Family of unknown function; Region: FAM86;
                     pfam14904"
                     /db_xref="CDD:464362"
     misc_feature    510..884
                     /gene="LOC108058189"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:473071"
     polyA_site      1125
                     /gene="LOC108058189"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aacggtcaca ctaatccaag tgccggtttc gattcacgtt gccactttcg ttcgcttgcc
       61 actgggtttt atccaaaata accgtggaaa tcgggaaatt ggagcggcgg aaaatgtctg
      121 ggaagtacga aaagctgcag cagcagttcc tctgctgcta tccggtgaac aagatggcct
      181 ggtcgtcggt ggcgtttccg ctaagctggg aggatcagca ggagctgatc gcggccacct
      241 gtggccatcc gctgaaccgt cgctttccgg tgcgtcgcag ctacctggag gccttcctca
      301 agcagctgat gcacctgctc cgcgaccagg aggatgtcca cgacgacata tacagcagct
      361 tgtgcggccc gatgggcgag aaggcgagca ctggttcagt tacgccatca gcctacgcct
      421 acaagcacta cctaatcgaa ccgggtgctc atataacgct ccgcgaatcc cggagctttg
      481 tggccgaagg caccaccggt ttgtgcacct gggaagcggc cctggccctc ggcgattacc
      541 tgctgcagca ccgtgacctc gtcgccggcc ggaacattgt ggagctggga gctggcgcag
      601 ggctcctggg agtcctgctc aaactgcctg ccctgcagct aaaaacgggc caggtgctgc
      661 tcaccgatgg cagtgagccc tgcgtccagc tgatgcgcga gaatatcgcc ctgaatttca
      721 gggatggccc gagggaagcg atgccccagg cggagcagct gaactgggat gcggtcagcg
      781 agtttccctg gcacgcccat cccgaaccgg atttgctact cgccgccgat gtgatctacg
      841 atgattccca gttcgatgcg ctgctaagtg ccctggattt cctgtacacg agacgaggca
      901 aggggctgga aaccctgctg gccagcacgg ttcggaatgt ggacacgctg cacaagttta
      961 tgacccagct gggtgataat aactacaagg tgactccctg tgcgaatgtc tcggcctgtg
     1021 ccagccactt ttgtcgcgat cacaccgccg ccgttcagat tatctccata cgacgctagt
     1081 tttagtccta aaataaaccg acacaacgaa aacaaacacc cacta