Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017142779 544 bp mRNA linear INV 09-DEC-2024 protein 7 homolog (LOC108058187), mRNA. ACCESSION XM_017142779 VERSION XM_017142779.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017142779.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..544 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..544 /gene="LOC108058187" /note="translation machinery-associated protein 7 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108058187" CDS 186..380 /gene="LOC108058187" /codon_start=1 /product="translation machinery-associated protein 7 homolog" /protein_id="XP_016998268.1" /db_xref="GeneID:108058187" /translation="MSGREGGKKKPLKAPKKDSKDMDEDDMAFKQKQKEQQKALDAAK ANASKKGPLVGGGIKKSGKK" misc_feature 192..347 /gene="LOC108058187" /note="Translation machinery associated TMA7; Region: TMA7; pfam09072" /db_xref="CDD:462671" polyA_site 544 /gene="LOC108058187" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgttaacct tttaattccc aaagaaactt gaaagtagtg aatttgcgac ttggtgacct 61 acaaaatttg aaaaaaccaa agcgcgccta atttagacat atcggtttgg cccaccctag 121 cccacgatag ctatcgccaa tcggtcggcg gaaatcgaat cggaaaaacg tgtgaaaaag 181 caatcatgtc tggacgcgag ggcggtaaga agaagccact gaaggcgccg aagaaggact 241 cgaaggacat ggacgaggac gacatggcct tcaagcagaa gcagaaggag cagcagaagg 301 ccctggacgc cgccaaggcg aatgcctcca aaaaggggcc cctcgtgggc ggcggcatca 361 agaagtcggg caagaagtga tgactgagcc actatccaat atccacaaca atccgcaaaa 421 tccacaaagc caccgggatc acacaactcg cccatgtgga gaccaaaatt gatcgtctag 481 ccagaagctt acattttttt tatacttacg cttaccatta aatagagcat tgtacgtcag 541 gcta