Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii translation machinery-associated


LOCUS       XM_017142779             544 bp    mRNA    linear   INV 09-DEC-2024
            protein 7 homolog (LOC108058187), mRNA.
ACCESSION   XM_017142779
VERSION     XM_017142779.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142779.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..544
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..544
                     /gene="LOC108058187"
                     /note="translation machinery-associated protein 7 homolog;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 Proteins"
                     /db_xref="GeneID:108058187"
     CDS             186..380
                     /gene="LOC108058187"
                     /codon_start=1
                     /product="translation machinery-associated protein 7
                     homolog"
                     /protein_id="XP_016998268.1"
                     /db_xref="GeneID:108058187"
                     /translation="MSGREGGKKKPLKAPKKDSKDMDEDDMAFKQKQKEQQKALDAAK
                     ANASKKGPLVGGGIKKSGKK"
     misc_feature    192..347
                     /gene="LOC108058187"
                     /note="Translation machinery associated TMA7; Region:
                     TMA7; pfam09072"
                     /db_xref="CDD:462671"
     polyA_site      544
                     /gene="LOC108058187"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgttaacct tttaattccc aaagaaactt gaaagtagtg aatttgcgac ttggtgacct
       61 acaaaatttg aaaaaaccaa agcgcgccta atttagacat atcggtttgg cccaccctag
      121 cccacgatag ctatcgccaa tcggtcggcg gaaatcgaat cggaaaaacg tgtgaaaaag
      181 caatcatgtc tggacgcgag ggcggtaaga agaagccact gaaggcgccg aagaaggact
      241 cgaaggacat ggacgaggac gacatggcct tcaagcagaa gcagaaggag cagcagaagg
      301 ccctggacgc cgccaaggcg aatgcctcca aaaaggggcc cctcgtgggc ggcggcatca
      361 agaagtcggg caagaagtga tgactgagcc actatccaat atccacaaca atccgcaaaa
      421 tccacaaagc caccgggatc acacaactcg cccatgtgga gaccaaaatt gatcgtctag
      481 ccagaagctt acattttttt tatacttacg cttaccatta aatagagcat tgtacgtcag
      541 gcta