Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Vacuolar protein sorting 37A


LOCUS       XM_017142778            1198 bp    mRNA    linear   INV 09-DEC-2024
            (Vsp37A), mRNA.
ACCESSION   XM_017142778
VERSION     XM_017142778.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142778.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1198
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1198
                     /gene="Vsp37A"
                     /note="Vacuolar protein sorting 37A; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108058186"
     CDS             214..774
                     /gene="Vsp37A"
                     /codon_start=1
                     /product="vacuolar protein sorting-associated protein 37C"
                     /protein_id="XP_016998267.2"
                     /db_xref="GeneID:108058186"
                     /translation="MPTTQHSQGDAAAAGKDSAENMPNLSTLSLDELKQLDRDPEFFD
                     DFIEEMSVVQHLNEELDSMMNQVESISRENESKGSHLVELKRRLSDDYTALKTLGEKC
                     DQLNKKYLKKSEEYAPQHIRELLQIAASNADADCDRHVEHFLNGKIDVQTFLNTYTSC
                     KKISAERKAKEERLGSQLSALERAGI"
     misc_feature    295..726
                     /gene="Vsp37A"
                     /note="Modifier of rudimentary (Mod(r)) protein; Region:
                     Mod_r; pfam07200"
                     /db_xref="CDD:462117"
     polyA_site      1198
                     /gene="Vsp37A"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cccgatccga aggcaaaaag cagcaggaaa gatcaggaaa tcagccgacg gcgattggcc
       61 ggggtcgcca acttccactg gaggtcagag ggtgctccag ttcgtgacga ccctgggctc
      121 tcatctggaa aacccattga acccaacgca caaccactgg aatttggaac ttggcaaagg
      181 aaaaggaaaa ggaaactaaa gagcacctat acaatgccca ccacacagca ttcgcaagga
      241 gacgctgccg ccgccgggaa ggattcggcg gagaatatgc ccaatctgtc cacattgtcg
      301 ctggacgaac tgaagcagct ggacagggat cccgagttct tcgacgactt catcgaggag
      361 atgtccgtgg tgcagcacct gaacgaggag ctcgactcga tgatgaacca ggtggagagc
      421 atatcaaggg agaacgagag caagggcagc catctggtgg agctgaagcg ccggctgagt
      481 gatgattaca cggctttgaa gacactgggc gagaagtgcg accagctgaa caagaagtac
      541 ttgaagaagt cggaggaata tgctccgcag cacataaggg aactccttca gattgccgcc
      601 tccaatgccg atgccgactg cgatcggcat gtggagcact tcctgaacgg aaagatcgat
      661 gtgcagacgt tcctcaacac ctacaccagt tgcaagaaga tcagcgccga gcgcaaggcc
      721 aaggaggagc gactgggctc ccagctgagt gctttggaac gggcaggcat ctaggattgc
      781 ttcgggggca tctacattgg ctgtgcaccg gctgtccact caatgttcat ctcgattcta
      841 catcctccag ccgccacgag tcgcaataat agtgtctaag caggataatc aatagagcaa
      901 ccgatacgag tcagatatat atatatttaa attgatggat ggccccgcct ctcagaacag
      961 aaacgaaaat cgctcgctag ttgtacgcta gatttaaaca cgtgtaaatc ggtggagtgg
     1021 cttgtaattc taattaatta tgttatgtcc aaaaatccaa aagtccagtc tccaaaaccc
     1081 aaatcccatg tattacccaa ataggctaga attgtttttg gtcccttatt ttgtcccatg
     1141 gccagcccaa tcgatatttt gtactatgta tatttaataa atattatgat ttatatga