Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017142778 1198 bp mRNA linear INV 09-DEC-2024 (Vsp37A), mRNA. ACCESSION XM_017142778 VERSION XM_017142778.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017142778.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1198 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1198 /gene="Vsp37A" /note="Vacuolar protein sorting 37A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108058186" CDS 214..774 /gene="Vsp37A" /codon_start=1 /product="vacuolar protein sorting-associated protein 37C" /protein_id="XP_016998267.2" /db_xref="GeneID:108058186" /translation="MPTTQHSQGDAAAAGKDSAENMPNLSTLSLDELKQLDRDPEFFD DFIEEMSVVQHLNEELDSMMNQVESISRENESKGSHLVELKRRLSDDYTALKTLGEKC DQLNKKYLKKSEEYAPQHIRELLQIAASNADADCDRHVEHFLNGKIDVQTFLNTYTSC KKISAERKAKEERLGSQLSALERAGI" misc_feature 295..726 /gene="Vsp37A" /note="Modifier of rudimentary (Mod(r)) protein; Region: Mod_r; pfam07200" /db_xref="CDD:462117" polyA_site 1198 /gene="Vsp37A" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cccgatccga aggcaaaaag cagcaggaaa gatcaggaaa tcagccgacg gcgattggcc 61 ggggtcgcca acttccactg gaggtcagag ggtgctccag ttcgtgacga ccctgggctc 121 tcatctggaa aacccattga acccaacgca caaccactgg aatttggaac ttggcaaagg 181 aaaaggaaaa ggaaactaaa gagcacctat acaatgccca ccacacagca ttcgcaagga 241 gacgctgccg ccgccgggaa ggattcggcg gagaatatgc ccaatctgtc cacattgtcg 301 ctggacgaac tgaagcagct ggacagggat cccgagttct tcgacgactt catcgaggag 361 atgtccgtgg tgcagcacct gaacgaggag ctcgactcga tgatgaacca ggtggagagc 421 atatcaaggg agaacgagag caagggcagc catctggtgg agctgaagcg ccggctgagt 481 gatgattaca cggctttgaa gacactgggc gagaagtgcg accagctgaa caagaagtac 541 ttgaagaagt cggaggaata tgctccgcag cacataaggg aactccttca gattgccgcc 601 tccaatgccg atgccgactg cgatcggcat gtggagcact tcctgaacgg aaagatcgat 661 gtgcagacgt tcctcaacac ctacaccagt tgcaagaaga tcagcgccga gcgcaaggcc 721 aaggaggagc gactgggctc ccagctgagt gctttggaac gggcaggcat ctaggattgc 781 ttcgggggca tctacattgg ctgtgcaccg gctgtccact caatgttcat ctcgattcta 841 catcctccag ccgccacgag tcgcaataat agtgtctaag caggataatc aatagagcaa 901 ccgatacgag tcagatatat atatatttaa attgatggat ggccccgcct ctcagaacag 961 aaacgaaaat cgctcgctag ttgtacgcta gatttaaaca cgtgtaaatc ggtggagtgg 1021 cttgtaattc taattaatta tgttatgtcc aaaaatccaa aagtccagtc tccaaaaccc 1081 aaatcccatg tattacccaa ataggctaga attgtttttg gtcccttatt ttgtcccatg 1141 gccagcccaa tcgatatttt gtactatgta tatttaataa atattatgat ttatatga