Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017142759 864 bp mRNA linear INV 09-DEC-2024 expressed on SiSo cells (LOC108058174), mRNA. ACCESSION XM_017142759 VERSION XM_017142759.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017142759.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..864 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..864 /gene="LOC108058174" /note="receptor-binding cancer antigen expressed on SiSo cells; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108058174" CDS 70..714 /gene="LOC108058174" /codon_start=1 /product="receptor-binding cancer antigen expressed on SiSo cells" /protein_id="XP_016998248.1" /db_xref="GeneID:108058174" /translation="MLQQIKMLVLGIITLCRRALCCFSRRRKLSHSGGSSAGSGDLQA VNVIVERGDFSAGGNPTSGRSTGPRERDWNSWDDSPRTVEEHIEQYRQRMAQPPTPPK EEPEPDFFSELTPTIKPQMKFYLEDPSASAAASQPSDFSRLQAQDLVPISNNADLEDW VDDNAGGWEELDTSQTKQILREKRRELRHQRQPAVRPAPPTVGAQRLSDGQRAA" polyA_site 864 /gene="LOC108058174" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gggaccaaaa aaccgaaaca tagtgtaaag taaataatag cgtataggtg tatttgaaac 61 caggtgacaa tgctgcagca aatcaagatg ctggtgctgg gcatcatcac gctgtgccgc 121 cgtgccctct gctgcttctc gcggcgccgg aagctgagcc acagcggcgg ctcctccgcc 181 ggatccggtg acctgcaggc ggtgaacgtg attgtggagc ggggcgactt ctccgccggc 241 ggaaatccca ccagcggcag gtcgacgggg ccgagggagc gggactggaa ctcctgggac 301 gacagtccgc ggaccgtcga ggagcacatc gagcagtatc gccagcggat ggcccagccg 361 cctacgccgc ccaaggagga acccgagccg gatttcttca gtgagctcac gcccaccata 421 aagccgcaga tgaagttcta cctggaggat ccatcggcga gtgcggcggc cagtcagcca 481 agtgactttt caagactgca ggcccaggac ttggtgccca ttagcaataa cgccgatctc 541 gaggactggg tggacgacaa tgccggcggc tgggaggagc tggacacctc gcagaccaag 601 cagattctgc gggagaagcg acgcgagttg cgccaccagc gacagccggc cgtccgcccg 661 gccccgccca ccgtgggcgc ccagcggctg agcgacggac agcgagcggc gtagttgtcg 721 acccccaaat tacctaaatt acctagcaca cccacaccca cattgaccat tccacaaccg 781 acgaccactt gcattctgtt tgccttttct tttgttcgat ttagttgatt ggccacacga 841 aataaatcta gcctttcact cgca