Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii receptor-binding cancer antigen


LOCUS       XM_017142759             864 bp    mRNA    linear   INV 09-DEC-2024
            expressed on SiSo cells (LOC108058174), mRNA.
ACCESSION   XM_017142759
VERSION     XM_017142759.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142759.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..864
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..864
                     /gene="LOC108058174"
                     /note="receptor-binding cancer antigen expressed on SiSo
                     cells; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:108058174"
     CDS             70..714
                     /gene="LOC108058174"
                     /codon_start=1
                     /product="receptor-binding cancer antigen expressed on
                     SiSo cells"
                     /protein_id="XP_016998248.1"
                     /db_xref="GeneID:108058174"
                     /translation="MLQQIKMLVLGIITLCRRALCCFSRRRKLSHSGGSSAGSGDLQA
                     VNVIVERGDFSAGGNPTSGRSTGPRERDWNSWDDSPRTVEEHIEQYRQRMAQPPTPPK
                     EEPEPDFFSELTPTIKPQMKFYLEDPSASAAASQPSDFSRLQAQDLVPISNNADLEDW
                     VDDNAGGWEELDTSQTKQILREKRRELRHQRQPAVRPAPPTVGAQRLSDGQRAA"
     polyA_site      864
                     /gene="LOC108058174"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gggaccaaaa aaccgaaaca tagtgtaaag taaataatag cgtataggtg tatttgaaac
       61 caggtgacaa tgctgcagca aatcaagatg ctggtgctgg gcatcatcac gctgtgccgc
      121 cgtgccctct gctgcttctc gcggcgccgg aagctgagcc acagcggcgg ctcctccgcc
      181 ggatccggtg acctgcaggc ggtgaacgtg attgtggagc ggggcgactt ctccgccggc
      241 ggaaatccca ccagcggcag gtcgacgggg ccgagggagc gggactggaa ctcctgggac
      301 gacagtccgc ggaccgtcga ggagcacatc gagcagtatc gccagcggat ggcccagccg
      361 cctacgccgc ccaaggagga acccgagccg gatttcttca gtgagctcac gcccaccata
      421 aagccgcaga tgaagttcta cctggaggat ccatcggcga gtgcggcggc cagtcagcca
      481 agtgactttt caagactgca ggcccaggac ttggtgccca ttagcaataa cgccgatctc
      541 gaggactggg tggacgacaa tgccggcggc tgggaggagc tggacacctc gcagaccaag
      601 cagattctgc gggagaagcg acgcgagttg cgccaccagc gacagccggc cgtccgcccg
      661 gccccgccca ccgtgggcgc ccagcggctg agcgacggac agcgagcggc gtagttgtcg
      721 acccccaaat tacctaaatt acctagcaca cccacaccca cattgaccat tccacaaccg
      781 acgaccactt gcattctgtt tgccttttct tttgttcgat ttagttgatt ggccacacga
      841 aataaatcta gcctttcact cgca