Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Odorant-binding protein 18a


LOCUS       XM_017142751             606 bp    mRNA    linear   INV 09-DEC-2024
            (Obp18a), mRNA.
ACCESSION   XM_017142751
VERSION     XM_017142751.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142751.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..606
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..606
                     /gene="Obp18a"
                     /note="Odorant-binding protein 18a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108058168"
     CDS             82..477
                     /gene="Obp18a"
                     /codon_start=1
                     /product="uncharacterized protein Obp18a"
                     /protein_id="XP_016998240.1"
                     /db_xref="GeneID:108058168"
                     /translation="MKVAQSFVLLWICLIATCELPGCLAQDSCMTKNNVTSAELEAIS
                     PSTPISDVSLAVKCYSRCVLDEYIGDDGRIDLEKVGSRGNKQEHIILAQCKQRYDDVT
                     DRLGCDYSFLMLRCLFKSPTSETRPINLI"
     misc_feature    160..441
                     /gene="Obp18a"
                     /note="Insect pheromone/odorant binding protein domains;
                     Region: PhBP; smart00708"
                     /db_xref="CDD:214783"
     misc_feature    order(259..261,271..273,283..285,409..411,430..432)
                     /gene="Obp18a"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:467938"
ORIGIN      
        1 ctgagttcaa atgggagggc taaaatctat ataagaccga tgattaagtg gtcagcgtta
       61 gtccgaaatt agtttttcgc catgaaggtt gcccaaagct tcgttctact atggatttgc
      121 ctgatagcta cgtgcgagtt gcctggctgc cttgcccaag actcttgcat gacgaagaac
      181 aatgtgacca gcgccgaact ggaggccatt tcaccatcca ctcccatttc tgatgtttcc
      241 ttggctgtca aatgctacag caggtgtgtg ctcgatgagt acatcggcga tgatgggagg
      301 atcgatctgg agaaggtggg aagtcgagga aacaaacagg agcatattat tctcgcccag
      361 tgtaagcagc gatacgatga cgtcaccgat cggctcggat gcgactattc atttctgatg
      421 ctccggtgtt tgtttaagag cccaacgagc gaaactcgac caattaacct tatataaata
      481 cgtatatgaa aaacgcgaag gttacaatat actatatata ttccatatac atcattcgct
      541 gataacaact taattcgttg aaattattaa tcacattaga ggcttattga tattgttaaa
      601 aataca