Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017142751 606 bp mRNA linear INV 09-DEC-2024 (Obp18a), mRNA. ACCESSION XM_017142751 VERSION XM_017142751.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017142751.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..606 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..606 /gene="Obp18a" /note="Odorant-binding protein 18a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108058168" CDS 82..477 /gene="Obp18a" /codon_start=1 /product="uncharacterized protein Obp18a" /protein_id="XP_016998240.1" /db_xref="GeneID:108058168" /translation="MKVAQSFVLLWICLIATCELPGCLAQDSCMTKNNVTSAELEAIS PSTPISDVSLAVKCYSRCVLDEYIGDDGRIDLEKVGSRGNKQEHIILAQCKQRYDDVT DRLGCDYSFLMLRCLFKSPTSETRPINLI" misc_feature 160..441 /gene="Obp18a" /note="Insect pheromone/odorant binding protein domains; Region: PhBP; smart00708" /db_xref="CDD:214783" misc_feature order(259..261,271..273,283..285,409..411,430..432) /gene="Obp18a" /note="ligand binding site [chemical binding]; other site" /db_xref="CDD:467938" ORIGIN 1 ctgagttcaa atgggagggc taaaatctat ataagaccga tgattaagtg gtcagcgtta 61 gtccgaaatt agtttttcgc catgaaggtt gcccaaagct tcgttctact atggatttgc 121 ctgatagcta cgtgcgagtt gcctggctgc cttgcccaag actcttgcat gacgaagaac 181 aatgtgacca gcgccgaact ggaggccatt tcaccatcca ctcccatttc tgatgtttcc 241 ttggctgtca aatgctacag caggtgtgtg ctcgatgagt acatcggcga tgatgggagg 301 atcgatctgg agaaggtggg aagtcgagga aacaaacagg agcatattat tctcgcccag 361 tgtaagcagc gatacgatga cgtcaccgat cggctcggat gcgactattc atttctgatg 421 ctccggtgtt tgtttaagag cccaacgagc gaaactcgac caattaacct tatataaata 481 cgtatatgaa aaacgcgaag gttacaatat actatatata ttccatatac atcattcgct 541 gataacaact taattcgttg aaattattaa tcacattaga ggcttattga tattgttaaa 601 aataca