Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017142750 713 bp mRNA linear INV 09-DEC-2024 (LOC108058167), transcript variant X1, mRNA. ACCESSION XM_017142750 VERSION XM_017142750.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017142750.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..713 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..713 /gene="LOC108058167" /note="uncharacterized LOC108058167; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108058167" CDS 193..636 /gene="LOC108058167" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016998239.2" /db_xref="GeneID:108058167" /translation="MSEPQKAQLKEIYALLNKENPSGVITVEDLNAVMQHLGRRPSTE ELREMVLAADSEGSGSVDFQRFCRMMIRAERELLLRESFQRFDRDGDGVLSAEELQLA LEETLEEEPDRATVQEMMQEGDPNGTGFISYANFMQMALKYQEDE" misc_feature 193..609 /gene="LOC108058167" /note="calmodulin; Provisional; Region: PTZ00184" /db_xref="CDD:185504" polyA_site 713 /gene="LOC108058167" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcctggtcaa ccaattcggc aatgtcagtt cccatttagt tcattcaaag tacaaacgcc 61 gctcgagcag caccggatac caaaaatata tttttgttac ttccattttt aaccaaagtg 121 caaaatttca aaattaaatt tgtgcaattg gagcaggata tcaaaagaaa gaaagaggga 181 aagtgaggca agatgagcga accacagaag gcgcaattga aggagatcta cgccctgttg 241 aacaaggaga atccctcggg ggtcatcacc gttgaggatc tgaatgccgt gatgcagcac 301 ctcggtcgtc gtccgagtac cgaggagctg cgcgaaatgg tcctggccgc cgattccgag 361 ggcagtggat ccgtggactt ccagcgcttc tgccgcatga tgatccgcgc ggaaagggag 421 ctgctgctgc gcgaatcctt ccagcgcttc gatcgcgatg gcgacggcgt gctctccgcc 481 gaggaactgc agctggccct ggaggagacc ctcgaggagg agcccgaccg ggccaccgtc 541 caggagatga tgcaggaggg cgaccccaac ggcaccgggt tcatctccta tgccaacttc 601 atgcaaatgg ccctcaagta ccaagaggat gaatagtgta tcgtaattta acagcaaggt 661 ccgcgaatac tccaaatgat gccgtcaatg aatatatttc atagaaactg tca