Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017142750             713 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108058167), transcript variant X1, mRNA.
ACCESSION   XM_017142750
VERSION     XM_017142750.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142750.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..713
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..713
                     /gene="LOC108058167"
                     /note="uncharacterized LOC108058167; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108058167"
     CDS             193..636
                     /gene="LOC108058167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016998239.2"
                     /db_xref="GeneID:108058167"
                     /translation="MSEPQKAQLKEIYALLNKENPSGVITVEDLNAVMQHLGRRPSTE
                     ELREMVLAADSEGSGSVDFQRFCRMMIRAERELLLRESFQRFDRDGDGVLSAEELQLA
                     LEETLEEEPDRATVQEMMQEGDPNGTGFISYANFMQMALKYQEDE"
     misc_feature    193..609
                     /gene="LOC108058167"
                     /note="calmodulin; Provisional; Region: PTZ00184"
                     /db_xref="CDD:185504"
     polyA_site      713
                     /gene="LOC108058167"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcctggtcaa ccaattcggc aatgtcagtt cccatttagt tcattcaaag tacaaacgcc
       61 gctcgagcag caccggatac caaaaatata tttttgttac ttccattttt aaccaaagtg
      121 caaaatttca aaattaaatt tgtgcaattg gagcaggata tcaaaagaaa gaaagaggga
      181 aagtgaggca agatgagcga accacagaag gcgcaattga aggagatcta cgccctgttg
      241 aacaaggaga atccctcggg ggtcatcacc gttgaggatc tgaatgccgt gatgcagcac
      301 ctcggtcgtc gtccgagtac cgaggagctg cgcgaaatgg tcctggccgc cgattccgag
      361 ggcagtggat ccgtggactt ccagcgcttc tgccgcatga tgatccgcgc ggaaagggag
      421 ctgctgctgc gcgaatcctt ccagcgcttc gatcgcgatg gcgacggcgt gctctccgcc
      481 gaggaactgc agctggccct ggaggagacc ctcgaggagg agcccgaccg ggccaccgtc
      541 caggagatga tgcaggaggg cgaccccaac ggcaccgggt tcatctccta tgccaacttc
      601 atgcaaatgg ccctcaagta ccaagaggat gaatagtgta tcgtaattta acagcaaggt
      661 ccgcgaatac tccaaatgat gccgtcaatg aatatatttc atagaaactg tca