Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017142728 1335 bp mRNA linear INV 09-DEC-2024 X2, mRNA. ACCESSION XM_017142728 VERSION XM_017142728.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017142728.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1335 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1335 /gene="arg" /note="arginase; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108058163" CDS 108..1211 /gene="arg" /codon_start=1 /product="arginase-1 isoform X2" /protein_id="XP_016998217.2" /db_xref="GeneID:108058163" /translation="MWWSRKLASRCLRLHRAKSTASSEPEQTLGIIGVPFAKGQGKQG VELAPDLLRQSSLRQVLQSSHDGLVIRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFM ACNRALIEQVKLMLAENSQFLAIGGDHAIGFGECPFHPILRPEIEWESLAGSVAGHLQ HTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLLEQLRTTWQHAGLQDIAPNCLPK DQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVPKIIEMTLDALDPQNKIHVSF DIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGVDLVEINPKLGSERDVR TTVESGLEILKSMFGYRRSGKWSNIDTGILGSD" misc_feature 192..1148 /gene="arg" /note="Arginase family; Region: Arginase; cd09989" /db_xref="CDD:212515" misc_feature order(492..494,618..620,624..626,630..632,636..638, 669..674,795..797,804..806,936..938,942..944,1071..1073) /gene="arg" /note="active site" /db_xref="CDD:212515" misc_feature order(786..788,792..794,807..809,816..821,843..851, 855..866,873..878,885..887,987..1010,1026..1028) /gene="arg" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:212515" polyA_site 1335 /gene="arg" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcgctgtcgt ctccactcca ccactcagtt gcggatcttc cagcgttgcg agcagagcga 61 aacagcatag aacagaaccg agttcaatac ccaatcgcat cccaaatatg tggtggagcc 121 gtaagttagc ctcaaggtgt ctccgcctcc atcgggccaa gagcaccgcc tccagcgaac 181 cggagcaaac gctgggcatc attggagtgc ccttcgccaa gggacagggc aaacagggcg 241 tggagctcgc tccggatctc ctccggcaga gcagcctgcg tcaggtgctg cagagcagtc 301 atgatggcct ggtgatacgg gactacggta atctgcagta tgccgtggac gagccccttc 361 tccagcagca gcgggtgcac taccaccaca tccggaacta cgcggacttt atggcctgca 421 atcgggctct gatcgagcag gtgaagctga tgctggcgga gaactcgcag ttcctggcca 481 ttggcggcga tcatgcgatt gggttcggtg agtgtccatt ccatccaatc ctccgtccag 541 aaatcgaatg ggaatctctt gcaggatcgg tggccggtca cctgcagcac acgccaaatt 601 tatcgctggt ctggatcgat gcgcatgcgg acatcaatct gcatagcacc tcgcagtcgg 661 gcaacatcca tgggatgccc gtgtccttcc tcctggaaca actccgtacc acctggcagc 721 acgccggcct ccaggacatc gcgcccaact gtttgcccaa ggatcagttg gtttacatcg 781 gactgcggga cattgacccc tacgaggcgt tcatattgaa caaagtcggg atacgctact 841 atgcgatgga taccatcgac cgtgtgggcg tgcccaagat catcgagatg accctggacg 901 ccctcgatcc gcagaacaag atccacgtga gcttcgacat cgacgccctg gacagcaacg 961 tggcgcccag caccgggacc gccgtgcgcg gcgggctcac cctgcgcgag ggcatcagca 1021 tcgtggaggc gctgagggac accaagcggg tgcagggcgt cgacctggtg gagatcaacc 1081 cgaagctggg cagcgagcgc gacgtgcgca ccaccgtgga gtccggcctg gagatcctga 1141 agagcatgtt cggctaccgg aggtccggca agtggagcaa catcgacact gggatcctgg 1201 gcagcgattg agccaaggaa aacatacagt tcttgtgctt atcaatattt atgtacaaca 1261 ttcttgccat atttgtgtgt gctttttttt tcgtatctta atgaaagaat aaacaagaaa 1321 ttagtttaaa gagaa