Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii arginase (arg), transcript variant


LOCUS       XM_017142728            1335 bp    mRNA    linear   INV 09-DEC-2024
            X2, mRNA.
ACCESSION   XM_017142728
VERSION     XM_017142728.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142728.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1335
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1335
                     /gene="arg"
                     /note="arginase; Derived by automated computational
                     analysis using gene prediction method: Gnomon."
                     /db_xref="GeneID:108058163"
     CDS             108..1211
                     /gene="arg"
                     /codon_start=1
                     /product="arginase-1 isoform X2"
                     /protein_id="XP_016998217.2"
                     /db_xref="GeneID:108058163"
                     /translation="MWWSRKLASRCLRLHRAKSTASSEPEQTLGIIGVPFAKGQGKQG
                     VELAPDLLRQSSLRQVLQSSHDGLVIRDYGNLQYAVDEPLLQQQRVHYHHIRNYADFM
                     ACNRALIEQVKLMLAENSQFLAIGGDHAIGFGECPFHPILRPEIEWESLAGSVAGHLQ
                     HTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLLEQLRTTWQHAGLQDIAPNCLPK
                     DQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVPKIIEMTLDALDPQNKIHVSF
                     DIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGVDLVEINPKLGSERDVR
                     TTVESGLEILKSMFGYRRSGKWSNIDTGILGSD"
     misc_feature    192..1148
                     /gene="arg"
                     /note="Arginase family; Region: Arginase; cd09989"
                     /db_xref="CDD:212515"
     misc_feature    order(492..494,618..620,624..626,630..632,636..638,
                     669..674,795..797,804..806,936..938,942..944,1071..1073)
                     /gene="arg"
                     /note="active site"
                     /db_xref="CDD:212515"
     misc_feature    order(786..788,792..794,807..809,816..821,843..851,
                     855..866,873..878,885..887,987..1010,1026..1028)
                     /gene="arg"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212515"
     polyA_site      1335
                     /gene="arg"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgctgtcgt ctccactcca ccactcagtt gcggatcttc cagcgttgcg agcagagcga
       61 aacagcatag aacagaaccg agttcaatac ccaatcgcat cccaaatatg tggtggagcc
      121 gtaagttagc ctcaaggtgt ctccgcctcc atcgggccaa gagcaccgcc tccagcgaac
      181 cggagcaaac gctgggcatc attggagtgc ccttcgccaa gggacagggc aaacagggcg
      241 tggagctcgc tccggatctc ctccggcaga gcagcctgcg tcaggtgctg cagagcagtc
      301 atgatggcct ggtgatacgg gactacggta atctgcagta tgccgtggac gagccccttc
      361 tccagcagca gcgggtgcac taccaccaca tccggaacta cgcggacttt atggcctgca
      421 atcgggctct gatcgagcag gtgaagctga tgctggcgga gaactcgcag ttcctggcca
      481 ttggcggcga tcatgcgatt gggttcggtg agtgtccatt ccatccaatc ctccgtccag
      541 aaatcgaatg ggaatctctt gcaggatcgg tggccggtca cctgcagcac acgccaaatt
      601 tatcgctggt ctggatcgat gcgcatgcgg acatcaatct gcatagcacc tcgcagtcgg
      661 gcaacatcca tgggatgccc gtgtccttcc tcctggaaca actccgtacc acctggcagc
      721 acgccggcct ccaggacatc gcgcccaact gtttgcccaa ggatcagttg gtttacatcg
      781 gactgcggga cattgacccc tacgaggcgt tcatattgaa caaagtcggg atacgctact
      841 atgcgatgga taccatcgac cgtgtgggcg tgcccaagat catcgagatg accctggacg
      901 ccctcgatcc gcagaacaag atccacgtga gcttcgacat cgacgccctg gacagcaacg
      961 tggcgcccag caccgggacc gccgtgcgcg gcgggctcac cctgcgcgag ggcatcagca
     1021 tcgtggaggc gctgagggac accaagcggg tgcagggcgt cgacctggtg gagatcaacc
     1081 cgaagctggg cagcgagcgc gacgtgcgca ccaccgtgga gtccggcctg gagatcctga
     1141 agagcatgtt cggctaccgg aggtccggca agtggagcaa catcgacact gggatcctgg
     1201 gcagcgattg agccaaggaa aacatacagt tcttgtgctt atcaatattt atgtacaaca
     1261 ttcttgccat atttgtgtgt gctttttttt tcgtatctta atgaaagaat aaacaagaaa
     1321 ttagtttaaa gagaa