Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii meiosis specific with OB domains


LOCUS       XM_017142133            1541 bp    mRNA    linear   INV 09-DEC-2024
            hold'em (hdm), mRNA.
ACCESSION   XM_017142133
VERSION     XM_017142133.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142133.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1541
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1541
                     /gene="hdm"
                     /note="meiosis specific with OB domains hold'em; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108057733"
     CDS             39..1484
                     /gene="hdm"
                     /codon_start=1
                     /product="protein hold'em"
                     /protein_id="XP_016997622.2"
                     /db_xref="GeneID:108057733"
                     /translation="MAKRVKFQRLAEMQPTMTHFAAVALIVSKSSPNIFYDKMSGTER
                     GCLTLTIRDSPNHLTNCKLWGQRACVDEYAAMLQIGHVVDIVGAKVMTIPKVPPGERR
                     YQPQATLPCALVVNEGSGYVVRHDGNDSDGRMKYLAQLLHHPVQPLGAVLKLSDVRLG
                     LGNPEQMVPAHVNLLVVVATVRPVRRIKRKLTQEALQCLEVIVFDASYPEGMLLSIWQ
                     PDWIRRAQQWEPRGTVLHLVDVRVSYSDFHRCPVLAHSNCTLICEQPQAAGEDCRLLL
                     AFAATVPPQSFDGSAQAELDNLPAASSIQAQMTVRQLYSRAEGELQEASAIQFTAVLF
                     GMVTKFDLDGLACHVNRKCTVCLRLIPKNREDCAGEACQMEFVLGSNGPRYTSHFNIN
                     IHLTDQTGTLIETRLAGGPAERILGIRAEDFEQLAEGDKSQLKWRFLLKYFEARLLVK
                     KPAGMRKNLVVVVVDMQTIPLETLVEKLAIF"
     misc_feature    549..>767
                     /gene="hdm"
                     /note="This superfamily includes two
                     oligonucleotide/oligosaccharide binding fold (OBF) domain
                     families. One of these contains the OBF domains of the
                     large (RPA1, 70kDa), middle (RPA2, RPA4, 32kDa) and small
                     (RPA3, 14 kDa) subunits of human heterotrimeric...;
                     Region: Replication protein A, class 2b aminoacyl-tRNA
                     synthetases, and related proteins with
                     oligonucleotide/oligosaccharide (OB) fold.; cl09930"
                     /db_xref="CDD:471953"
     misc_feature    order(555..557,738..740,744..746,750..752)
                     /gene="hdm"
                     /note="generic binding surface II [active]"
                     /db_xref="CDD:239601"
     misc_feature    order(570..578,636..647,651..653,675..683,687..689,
                     726..728,759..767)
                     /gene="hdm"
                     /note="generic binding surface I [active]"
                     /db_xref="CDD:239601"
ORIGIN      
        1 ttccaacttg gttcaacgaa atttccctaa taactttaat ggctaagcgc gtgaaattcc
       61 agcgcctggc ggagatgcag cccacgatga cccacttcgc cgccgtggcg ctgatcgtct
      121 ccaaatcctc gccgaatatc ttctacgaca agatgagtgg caccgaacgc ggatgcctca
      181 ctctgaccat ccgggattca cccaatcacc tgaccaactg caagttgtgg ggtcagcggg
      241 cctgcgtgga tgagtacgcg gccatgctgc agatcggcca tgtggtggac atagtgggag
      301 ccaaggtgat gaccattccg aaggttccgc cgggcgaaag gcgctatcag ccgcaggcga
      361 cgcttccctg cgccctggtg gtcaacgagg gatccggcta tgtggtgcga cacgacggca
      421 atgactcgga tggcaggatg aagtacctgg cccagctgct ccatcatccc gtccagcccc
      481 tgggcgccgt gctcaagcta tcggatgtcc gtttggggct aggaaacccc gagcagatgg
      541 tccccgccca tgtgaaccta ctggtggtcg tggctaccgt gcgtccagtg cgtcggatca
      601 agcgaaagct cacccaggag gcgctgcaat gcctggaggt gattgtgttc gatgccagct
      661 atccggaggg catgctcctc tccatttggc aaccggattg gatacgccgt gcccagcagt
      721 gggagccacg cggcacggtg cttcacctgg tcgatgtgcg ggtctcttac tcggacttcc
      781 atcgctgccc tgtgctcgcc cactccaact gcacgctcat ctgcgagcag ccccaggcgg
      841 ctggcgagga ttgccgtttg ctgctggcct ttgccgccac tgtgccgccc cagagcttcg
      901 atggcagcgc ccaggcggag ctggacaacc tgccggcagc cagcagcatt caggcccaga
      961 tgaccgtcag gcagttgtat tcccgagcgg agggcgaact gcaggaagct tccgccattc
     1021 agttcactgc tgtgctcttt ggcatggtca ccaagttcga cctggatgga ttggcctgcc
     1081 atgtcaacag aaagtgcacc gtttgcctgc gactcattcc aaaaaaccgc gaggattgcg
     1141 ccggggaagc ctgtcagatg gaattcgtgc tgggcagcaa tggccctcga tacaccagcc
     1201 acttcaacat taacattcac ttgaccgacc agacgggcac cctgatcgag acccgtttgg
     1261 ctggcggtcc ggcggagagg atcctgggca tccgagcgga ggacttcgag cagctggcgg
     1321 agggcgacaa gagccagctg aagtggcgct tcctgctgaa atatttcgag gctagattgc
     1381 tggtcaaaaa gcccgcggga atgcgcaaaa atctcgtagt tgtggtggtg gatatgcaaa
     1441 caattccact ggaaacgctg gtcgagaagt tggccatttt ctagtagtaa tgaaaagact
     1501 ggtcgagcaa ctacataaat agcgatcttt atttcgcatt t