Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017142133 1541 bp mRNA linear INV 09-DEC-2024 hold'em (hdm), mRNA. ACCESSION XM_017142133 VERSION XM_017142133.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017142133.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1541 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1541 /gene="hdm" /note="meiosis specific with OB domains hold'em; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108057733" CDS 39..1484 /gene="hdm" /codon_start=1 /product="protein hold'em" /protein_id="XP_016997622.2" /db_xref="GeneID:108057733" /translation="MAKRVKFQRLAEMQPTMTHFAAVALIVSKSSPNIFYDKMSGTER GCLTLTIRDSPNHLTNCKLWGQRACVDEYAAMLQIGHVVDIVGAKVMTIPKVPPGERR YQPQATLPCALVVNEGSGYVVRHDGNDSDGRMKYLAQLLHHPVQPLGAVLKLSDVRLG LGNPEQMVPAHVNLLVVVATVRPVRRIKRKLTQEALQCLEVIVFDASYPEGMLLSIWQ PDWIRRAQQWEPRGTVLHLVDVRVSYSDFHRCPVLAHSNCTLICEQPQAAGEDCRLLL AFAATVPPQSFDGSAQAELDNLPAASSIQAQMTVRQLYSRAEGELQEASAIQFTAVLF GMVTKFDLDGLACHVNRKCTVCLRLIPKNREDCAGEACQMEFVLGSNGPRYTSHFNIN IHLTDQTGTLIETRLAGGPAERILGIRAEDFEQLAEGDKSQLKWRFLLKYFEARLLVK KPAGMRKNLVVVVVDMQTIPLETLVEKLAIF" misc_feature 549..>767 /gene="hdm" /note="This superfamily includes two oligonucleotide/oligosaccharide binding fold (OBF) domain families. One of these contains the OBF domains of the large (RPA1, 70kDa), middle (RPA2, RPA4, 32kDa) and small (RPA3, 14 kDa) subunits of human heterotrimeric...; Region: Replication protein A, class 2b aminoacyl-tRNA synthetases, and related proteins with oligonucleotide/oligosaccharide (OB) fold.; cl09930" /db_xref="CDD:471953" misc_feature order(555..557,738..740,744..746,750..752) /gene="hdm" /note="generic binding surface II [active]" /db_xref="CDD:239601" misc_feature order(570..578,636..647,651..653,675..683,687..689, 726..728,759..767) /gene="hdm" /note="generic binding surface I [active]" /db_xref="CDD:239601" ORIGIN 1 ttccaacttg gttcaacgaa atttccctaa taactttaat ggctaagcgc gtgaaattcc 61 agcgcctggc ggagatgcag cccacgatga cccacttcgc cgccgtggcg ctgatcgtct 121 ccaaatcctc gccgaatatc ttctacgaca agatgagtgg caccgaacgc ggatgcctca 181 ctctgaccat ccgggattca cccaatcacc tgaccaactg caagttgtgg ggtcagcggg 241 cctgcgtgga tgagtacgcg gccatgctgc agatcggcca tgtggtggac atagtgggag 301 ccaaggtgat gaccattccg aaggttccgc cgggcgaaag gcgctatcag ccgcaggcga 361 cgcttccctg cgccctggtg gtcaacgagg gatccggcta tgtggtgcga cacgacggca 421 atgactcgga tggcaggatg aagtacctgg cccagctgct ccatcatccc gtccagcccc 481 tgggcgccgt gctcaagcta tcggatgtcc gtttggggct aggaaacccc gagcagatgg 541 tccccgccca tgtgaaccta ctggtggtcg tggctaccgt gcgtccagtg cgtcggatca 601 agcgaaagct cacccaggag gcgctgcaat gcctggaggt gattgtgttc gatgccagct 661 atccggaggg catgctcctc tccatttggc aaccggattg gatacgccgt gcccagcagt 721 gggagccacg cggcacggtg cttcacctgg tcgatgtgcg ggtctcttac tcggacttcc 781 atcgctgccc tgtgctcgcc cactccaact gcacgctcat ctgcgagcag ccccaggcgg 841 ctggcgagga ttgccgtttg ctgctggcct ttgccgccac tgtgccgccc cagagcttcg 901 atggcagcgc ccaggcggag ctggacaacc tgccggcagc cagcagcatt caggcccaga 961 tgaccgtcag gcagttgtat tcccgagcgg agggcgaact gcaggaagct tccgccattc 1021 agttcactgc tgtgctcttt ggcatggtca ccaagttcga cctggatgga ttggcctgcc 1081 atgtcaacag aaagtgcacc gtttgcctgc gactcattcc aaaaaaccgc gaggattgcg 1141 ccggggaagc ctgtcagatg gaattcgtgc tgggcagcaa tggccctcga tacaccagcc 1201 acttcaacat taacattcac ttgaccgacc agacgggcac cctgatcgag acccgtttgg 1261 ctggcggtcc ggcggagagg atcctgggca tccgagcgga ggacttcgag cagctggcgg 1321 agggcgacaa gagccagctg aagtggcgct tcctgctgaa atatttcgag gctagattgc 1381 tggtcaaaaa gcccgcggga atgcgcaaaa atctcgtagt tgtggtggtg gatatgcaaa 1441 caattccact ggaaacgctg gtcgagaagt tggccatttt ctagtagtaa tgaaaagact 1501 ggtcgagcaa ctacataaat agcgatcttt atttcgcatt t