PREDICTED: Drosophila takahashii mitochondrial import inner

LOCUS       XM_017142114             688 bp    mRNA    linear   INV 09-DEC-2024
            membrane translocase subunit TIM16 (LOC108057721), mRNA.
ACCESSION   XM_017142114
VERSION     XM_017142114.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142114.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..688
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..688
                     /gene="LOC108057721"
                     /note="mitochondrial import inner membrane translocase
                     subunit TIM16; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:108057721"
     CDS             95..532
                     /gene="LOC108057721"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit TIM16"
                     /protein_id="XP_016997603.2"
                     /db_xref="GeneID:108057721"
                     /translation="MARYLAQIIILGAQVVGRALVKTLRQEMQAFEDAARMHETMSAN
                     LPSSSKAKVKGMTLVEAQQILNVKDLSDHQTIDSHYRHLFQANEKSSGGTFYLQSKVF
                     RAKERIDDELARLEQLAKTKIDPPSPPASPSIDQSKEPGHQSR"
     misc_feature    95..460
                     /gene="LOC108057721"
                     /note="DnaJ domain or J-domain. DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cl02542"
                     /db_xref="CDD:413365"
ORIGIN      
        1 acttcacttc tattctaatt cctattatgt tcaggttctg atttcggaga tctctaagca
       61 atcgcaagca aaattcccaa tagacaagca ggcaatggca cggtacctag cgcagatcat
      121 aattttgggt gcccaggtgg tggggcgggc gttggtgaag acgctgcgac aggagatgca
      181 agccttcgag gatgcggcgc gaatgcatga gaccatgagc gccaacttgc ccagcagcag
      241 caaagcgaag gtcaagggca tgaccctggt ggaggcccag cagatcctca atgtgaagga
      301 cctgagtgac catcagacca tcgactcgca ttaccggcat ttgttccagg cgaacgagaa
      361 gtcctccggc ggcaccttct acctccagtc gaaggtcttt cgggccaagg agcgaatcga
      421 cgacgaactg gccaggctgg agcagctggc caaaacgaag atcgatcccc cttccccgcc
      481 agcatcgcca tctatagacc aatccaaaga gccgggtcat cagagccggt gatcattccc
      541 ggctgaattc ccggcctggc ttttccgtgg cgtgcaatcg atctgtcctg tcatgttaac
      601 taccaaatcg tctttcaagt acatgtgtgc atatgtaaat cgtcaaataa ataacttcaa
      661 actctgtaat ataaaatata aatataaa