Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017142113             305 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108057719), transcript variant X2, mRNA.
ACCESSION   XM_017142113
VERSION     XM_017142113.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142113.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..305
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..305
                     /gene="LOC108057719"
                     /note="uncharacterized LOC108057719; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108057719"
     CDS             141..305
                     /gene="LOC108057719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016997602.1"
                     /db_xref="GeneID:108057719"
                     /translation="MGSGIVVQLARKYGAVIFFPTVAVGSIYADWSHTREWKRQQLQL
                     AHSAQLRDQQ"
ORIGIN      
        1 caaattggag tgcaaaatcc aggaaaaata cccacaaagt ccaaaaccaa gacttggcag
       61 cagcaggtgt gagaagggtt cggcgaaacc gactaaataa acacgtcgct cgggagattt
      121 cagtcatttt cattacaccc atgggcagtg ggattgtggt gcaattggct cgaaagtacg
      181 gcgcagtgat attctttccc actgttgcag tcggctcgat atacgcagat tggtcgcaca
      241 cccgcgagtg gaaacgccag cagctccagt tggcacacag cgcccagttg agggatcagc
      301 aatag