Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017142113 305 bp mRNA linear INV 09-DEC-2024 (LOC108057719), transcript variant X2, mRNA. ACCESSION XM_017142113 VERSION XM_017142113.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017142113.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..305 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..305 /gene="LOC108057719" /note="uncharacterized LOC108057719; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108057719" CDS 141..305 /gene="LOC108057719" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016997602.1" /db_xref="GeneID:108057719" /translation="MGSGIVVQLARKYGAVIFFPTVAVGSIYADWSHTREWKRQQLQL AHSAQLRDQQ" ORIGIN 1 caaattggag tgcaaaatcc aggaaaaata cccacaaagt ccaaaaccaa gacttggcag 61 cagcaggtgt gagaagggtt cggcgaaacc gactaaataa acacgtcgct cgggagattt 121 cagtcatttt cattacaccc atgggcagtg ggattgtggt gcaattggct cgaaagtacg 181 gcgcagtgat attctttccc actgttgcag tcggctcgat atacgcagat tggtcgcaca 241 cccgcgagtg gaaacgccag cagctccagt tggcacacag cgcccagttg agggatcagc 301 aatag