Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017142112             292 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108057719), transcript variant X3, mRNA.
ACCESSION   XM_017142112
VERSION     XM_017142112.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142112.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..292
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..292
                     /gene="LOC108057719"
                     /note="uncharacterized LOC108057719; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108057719"
     CDS             128..292
                     /gene="LOC108057719"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016997601.1"
                     /db_xref="GeneID:108057719"
                     /translation="MGSGIVVQLARKYGAVIFFPTVAVGSIYADWSHTREWKRQQLQL
                     AHSAQLRDQQ"
ORIGIN      
        1 gtcgacagcc ctggtgctat cgatgctata agtaagttaa aaacaaacct aatttagcaa
       61 attggagtgc aaaatccagg aaaaataccc acaaagtcca aaaccaagac ttggcagcag
      121 cagacccatg ggcagtggga ttgtggtgca attggctcga aagtacggcg cagtgatatt
      181 ctttcccact gttgcagtcg gctcgatata cgcagattgg tcgcacaccc gcgagtggaa
      241 acgccagcag ctccagttgg cacacagcgc ccagttgagg gatcagcaat ag