Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017142112 292 bp mRNA linear INV 09-DEC-2024 (LOC108057719), transcript variant X3, mRNA. ACCESSION XM_017142112 VERSION XM_017142112.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017142112.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..292 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..292 /gene="LOC108057719" /note="uncharacterized LOC108057719; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108057719" CDS 128..292 /gene="LOC108057719" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016997601.1" /db_xref="GeneID:108057719" /translation="MGSGIVVQLARKYGAVIFFPTVAVGSIYADWSHTREWKRQQLQL AHSAQLRDQQ" ORIGIN 1 gtcgacagcc ctggtgctat cgatgctata agtaagttaa aaacaaacct aatttagcaa 61 attggagtgc aaaatccagg aaaaataccc acaaagtcca aaaccaagac ttggcagcag 121 cagacccatg ggcagtggga ttgtggtgca attggctcga aagtacggcg cagtgatatt 181 ctttcccact gttgcagtcg gctcgatata cgcagattgg tcgcacaccc gcgagtggaa 241 acgccagcag ctccagttgg cacacagcgc ccagttgagg gatcagcaat ag