Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii NADH dehydrogenase (ubiquinone)


LOCUS       XM_017142110             257 bp    mRNA    linear   INV 09-DEC-2024
            MNLL subunit (ND-MNLL), mRNA.
ACCESSION   XM_017142110
VERSION     XM_017142110.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017142110.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..257
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..257
                     /gene="ND-MNLL"
                     /note="NADH dehydrogenase (ubiquinone) MNLL subunit;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 4 Proteins"
                     /db_xref="GeneID:108057718"
     CDS             1..171
                     /gene="ND-MNLL"
                     /codon_start=1
                     /product="uncharacterized protein ND-MNLL"
                     /protein_id="XP_016997599.1"
                     /db_xref="GeneID:108057718"
                     /translation="MVLGLDKRALWGALPLLGFAIGHFLDKKETDRMTMFRDKSALYG
                     RPAGSEDKAPSW"
     misc_feature    <49..>135
                     /gene="ND-MNLL"
                     /note="MNLL subunit; Region: NADH_oxidored; pfam08040"
                     /db_xref="CDD:462345"
     polyA_site      257
                     /gene="ND-MNLL"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atggtcttgg gactggacaa gcgtgctttg tggggcgctt tgcccctgct gggcttcgcc
       61 atcgggcact tcctggacaa gaaggagacg gaccgcatga ccatgttccg ggacaagagc
      121 gccctctacg gtcgtcccgc cggcagcgag gataaggcac catcctggta gtcctaccat
      181 actttttttt cccccacaca aaactcactg ttaaccaata aaccggagaa atgtgaaaat
      241 cacccattta cctggca