Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017142110 257 bp mRNA linear INV 09-DEC-2024 MNLL subunit (ND-MNLL), mRNA. ACCESSION XM_017142110 VERSION XM_017142110.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017142110.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..257 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..257 /gene="ND-MNLL" /note="NADH dehydrogenase (ubiquinone) MNLL subunit; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108057718" CDS 1..171 /gene="ND-MNLL" /codon_start=1 /product="uncharacterized protein ND-MNLL" /protein_id="XP_016997599.1" /db_xref="GeneID:108057718" /translation="MVLGLDKRALWGALPLLGFAIGHFLDKKETDRMTMFRDKSALYG RPAGSEDKAPSW" misc_feature <49..>135 /gene="ND-MNLL" /note="MNLL subunit; Region: NADH_oxidored; pfam08040" /db_xref="CDD:462345" polyA_site 257 /gene="ND-MNLL" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atggtcttgg gactggacaa gcgtgctttg tggggcgctt tgcccctgct gggcttcgcc 61 atcgggcact tcctggacaa gaaggagacg gaccgcatga ccatgttccg ggacaagagc 121 gccctctacg gtcgtcccgc cggcagcgag gataaggcac catcctggta gtcctaccat 181 actttttttt cccccacaca aaactcactg ttaaccaata aaccggagaa atgtgaaaat 241 cacccattta cctggca