Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Peritrophin A (Peritrophin-A),


LOCUS       XM_017141497            1216 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017141497
VERSION     XM_017141497.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141497.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1216
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1216
                     /gene="Peritrophin-A"
                     /note="Peritrophin A; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 7 Proteins"
                     /db_xref="GeneID:108057297"
     CDS             151..843
                     /gene="Peritrophin-A"
                     /codon_start=1
                     /product="protein obstructor-E"
                     /protein_id="XP_016996986.1"
                     /db_xref="GeneID:108057297"
                     /translation="MQRFQVCSVLILAWIACGHALAVGSPECPEKYGEQAYAHTENCD
                     QFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVDCKGRHWDPTPISTPACEYQF
                     GLYAVSKDCSTTYIKCAHGEPHEQDCDAGLAYDERIHGCNWPDQLLDHCNPEAVVGFK
                     CPTKVDPNSVAARFWPFPRFPVSGDCHRLITCVEGHPRLISCGEDKVFDEHTLTCEEP
                     EYASGSCANYGK"
     misc_feature    232..399
                     /gene="Peritrophin-A"
                     /note="Chitin binding Peritrophin-A domain; Region:
                     CBM_14; pfam01607"
                     /db_xref="CDD:426342"
     misc_feature    457..597
                     /gene="Peritrophin-A"
                     /note="Chitin binding Peritrophin-A domain; Region:
                     CBM_14; pfam01607"
                     /db_xref="CDD:426342"
     misc_feature    685..804
                     /gene="Peritrophin-A"
                     /note="Chitin-binding domain type 2; Region: ChtBD2;
                     smart00494"
                     /db_xref="CDD:214696"
     polyA_site      1216
                     /gene="Peritrophin-A"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaatcttttc agttgagttt ggaacgcgta accgttaaaa cgtacagacc tctttggagc
       61 ggaagtttca acatttcttt ggtttctggt atctggggga cttttttgct gcgcgtattt
      121 gaatatatat atttttttac ggaactaaaa atgcagcgat tccaagtttg cagtgtcctt
      181 atcctcgcct ggattgcctg tggacatgcc ctggccgtgg gatctccgga gtgccccgag
      241 aagtacggcg aacaggccta cgcccacacg gagaactgcg accagttctt cctctgcacc
      301 aacggcaccc tgaccctgga gacctgcgag aacggactgc tcttcgacgg caagggcgcg
      361 gtgcacaatc actgcaacta caactgggcg gtggactgca agggtcgcca ctgggatccc
      421 actcccatct ccacgccggc ctgcgagtac cagttcggtc tgtacgcggt ctccaaggac
      481 tgctccacca cctacatcaa gtgcgcccac ggagagcccc atgagcagga ctgcgacgcc
      541 ggtttggcct acgacgaaag gatccacggc tgcaactggc ccgatcagct gctggaccac
      601 tgcaatcccg aggctgtcgt cggcttcaag tgccccacca aggtggatcc gaactcggtg
      661 gccgcccgct tctggccctt cccccgcttc ccggtgtccg gcgactgcca ccggctgatc
      721 acctgcgtgg aggggcatcc ccgcctgatc agctgcggcg aggacaaggt cttcgacgag
      781 cacacgctga cctgcgagga gccggagtac gccagcggaa gctgtgccaa ctacggcaaa
      841 tagagggatt gccgatcgtc ctgtacatat atttgcccac gaaccgacta cagtgcaatc
      901 tcgataatgt gaacgtttaa attaaagaaa aaatcccttt tgtttgctgc aacttctgaa
      961 cgagttatta tgttggttcc cttggttttc actaattcga gtgtgcactg tactgtaaag
     1021 cccccactaa ctactttgac ttcccctttt ctctatccag cttgcactgt aaaaaacttc
     1081 ctagcccaat agcttgttaa ctcgttgctt ttttaacgcc tccacattgt ttgtctcttt
     1141 tcctgtatta ttaacttgtt tgctgtttgg tctcttttgt atatgaatcg caataaagtt
     1201 aattttattt attgta