Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii syntaxin 16 (Syx16), mRNA.


LOCUS       XM_017141495            1173 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017141495
VERSION     XM_017141495.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141495.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1173
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1173
                     /gene="Syx16"
                     /note="syntaxin 16; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108057295"
     CDS             96..1142
                     /gene="Syx16"
                     /codon_start=1
                     /product="syntaxin-16"
                     /protein_id="XP_016996984.2"
                     /db_xref="GeneID:108057295"
                     /translation="MTSRNLTEVFVIMRNNASKNRSHYDDRRGSDAERLLKHSVREAE
                     EGLELQDDYGTPPAWLDKFEEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQQDDECD
                     IEVLSQIVSKLITSTHRHIQCVRSSIGVGSKVEQCLTANAVHCALLQLQELTVKFRAS
                     QNAYLLQLNSREERSQKYFEDKSDGGEIFTNVELGENFVDSFDNFLQPPAAEGKVSGN
                     SYLFSDDDQAIDDHFQRPPASRMTQQQLLLFEEENSRVAQHREQEVTKIVRSIYDLND
                     IFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNRKMCVILVLAA
                     ITFFMLLLLILTKL"
     misc_feature    <711..1112
                     /gene="Syx16"
                     /note="t-SNARE complex subunit, syntaxin [Intracellular
                     trafficking and secretion]; Region: COG5325"
                     /db_xref="CDD:227635"
     misc_feature    864..1040
                     /gene="Syx16"
                     /note="SNARE motif of syntaxin 16; Region:
                     SNARE_syntaxin16; cd15845"
                     /db_xref="CDD:277198"
     misc_feature    order(867..869,873..878,882..899,903..911,915..920,
                     924..932,936..941,945..953,957..962,966..983,987..1004,
                     1008..1025,1029..1037)
                     /gene="Syx16"
                     /note="heterotetramer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:277198"
     misc_feature    957..959
                     /gene="Syx16"
                     /note="zero layer; other site"
                     /db_xref="CDD:277198"
ORIGIN      
        1 ctgcacagct gagccaaaac caataggaac ccgattccaa tcagaagttt gaaaagtatc
       61 gatccccccc agaaattcgg gagcagaggg ccaggatgac gtcgcgcaac ctgacggagg
      121 tgtttgtcat catgcgcaac aatgcgtcca agaaccggag tcactacgac gaccggcggg
      181 gcagcgatgc ggagcgcctg ctgaagcact cggtgcggga ggcggaggag ggtctggagc
      241 tgcaggacga ctacggcacg ccgccggcct ggctggacaa gttcgaggag gcgcagtaca
      301 cgatgtcgaa gatcaaaccc aagctggatg agctgggctc gctgcatgcg cggcacctcc
      361 tgcgacccgc tttcgatgac cagcaggacg acgagtgcga catcgaggtg ctcagccaga
      421 tcgtctccaa gctgatcacc tccacgcacc ggcacatcca gtgcgtccgc tccagcatcg
      481 gcgtgggcag caaggtggag cagtgcctca ccgcgaatgc ggtgcactgt gcgctcctcc
      541 agctgcagga gctgacggtc aagttccggg ccagccagaa tgcctacctt ttgcagctca
      601 actccaggga ggagcgatcc cagaagtatt tcgaggataa aagtgacgga ggagaaatct
      661 ttaccaacgt ggagctgggc gagaactttg tggactcctt tgacaacttc ctgcagcctc
      721 cagcggcgga gggaaaggtt tctggcaata gctacctatt ttcggacgac gaccaggcca
      781 tagatgacca cttccagcgg ccgccagcca gcaggatgac ccagcagcag ctactcctct
      841 tcgaggagga gaactcgcgg gtggcgcagc atcgcgagca ggaggtgacc aagatagtcc
      901 gttccatcta cgacctaaac gacatcttca aggatctggg gcacatggtg caggagcagg
      961 gcaccgtcct ggatcgcatc gactacaatg tggagcagac gcagacgcgc gtctcggagg
     1021 gattgcggca gctgcacaag gcggagatgt atcagcgcaa gaatcgcaag atgtgtgtga
     1081 ttctcgtact ggctgccatt accttcttca tgctgctgct gctcatcctg accaagctgt
     1141 agggttaatc caattccaat tccatatgtg tgt