Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141495 1173 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017141495 VERSION XM_017141495.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141495.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1173 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1173 /gene="Syx16" /note="syntaxin 16; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108057295" CDS 96..1142 /gene="Syx16" /codon_start=1 /product="syntaxin-16" /protein_id="XP_016996984.2" /db_xref="GeneID:108057295" /translation="MTSRNLTEVFVIMRNNASKNRSHYDDRRGSDAERLLKHSVREAE EGLELQDDYGTPPAWLDKFEEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQQDDECD IEVLSQIVSKLITSTHRHIQCVRSSIGVGSKVEQCLTANAVHCALLQLQELTVKFRAS QNAYLLQLNSREERSQKYFEDKSDGGEIFTNVELGENFVDSFDNFLQPPAAEGKVSGN SYLFSDDDQAIDDHFQRPPASRMTQQQLLLFEEENSRVAQHREQEVTKIVRSIYDLND IFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNRKMCVILVLAA ITFFMLLLLILTKL" misc_feature <711..1112 /gene="Syx16" /note="t-SNARE complex subunit, syntaxin [Intracellular trafficking and secretion]; Region: COG5325" /db_xref="CDD:227635" misc_feature 864..1040 /gene="Syx16" /note="SNARE motif of syntaxin 16; Region: SNARE_syntaxin16; cd15845" /db_xref="CDD:277198" misc_feature order(867..869,873..878,882..899,903..911,915..920, 924..932,936..941,945..953,957..962,966..983,987..1004, 1008..1025,1029..1037) /gene="Syx16" /note="heterotetramer interface [polypeptide binding]; other site" /db_xref="CDD:277198" misc_feature 957..959 /gene="Syx16" /note="zero layer; other site" /db_xref="CDD:277198" ORIGIN 1 ctgcacagct gagccaaaac caataggaac ccgattccaa tcagaagttt gaaaagtatc 61 gatccccccc agaaattcgg gagcagaggg ccaggatgac gtcgcgcaac ctgacggagg 121 tgtttgtcat catgcgcaac aatgcgtcca agaaccggag tcactacgac gaccggcggg 181 gcagcgatgc ggagcgcctg ctgaagcact cggtgcggga ggcggaggag ggtctggagc 241 tgcaggacga ctacggcacg ccgccggcct ggctggacaa gttcgaggag gcgcagtaca 301 cgatgtcgaa gatcaaaccc aagctggatg agctgggctc gctgcatgcg cggcacctcc 361 tgcgacccgc tttcgatgac cagcaggacg acgagtgcga catcgaggtg ctcagccaga 421 tcgtctccaa gctgatcacc tccacgcacc ggcacatcca gtgcgtccgc tccagcatcg 481 gcgtgggcag caaggtggag cagtgcctca ccgcgaatgc ggtgcactgt gcgctcctcc 541 agctgcagga gctgacggtc aagttccggg ccagccagaa tgcctacctt ttgcagctca 601 actccaggga ggagcgatcc cagaagtatt tcgaggataa aagtgacgga ggagaaatct 661 ttaccaacgt ggagctgggc gagaactttg tggactcctt tgacaacttc ctgcagcctc 721 cagcggcgga gggaaaggtt tctggcaata gctacctatt ttcggacgac gaccaggcca 781 tagatgacca cttccagcgg ccgccagcca gcaggatgac ccagcagcag ctactcctct 841 tcgaggagga gaactcgcgg gtggcgcagc atcgcgagca ggaggtgacc aagatagtcc 901 gttccatcta cgacctaaac gacatcttca aggatctggg gcacatggtg caggagcagg 961 gcaccgtcct ggatcgcatc gactacaatg tggagcagac gcagacgcgc gtctcggagg 1021 gattgcggca gctgcacaag gcggagatgt atcagcgcaa gaatcgcaag atgtgtgtga 1081 ttctcgtact ggctgccatt accttcttca tgctgctgct gctcatcctg accaagctgt 1141 agggttaatc caattccaat tccatatgtg tgt