Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii delta(3,5)-Delta(2,4)-dienoyl-CoA


LOCUS       XM_017141491            1098 bp    mRNA    linear   INV 09-DEC-2024
            isomerase, mitochondrial (LOC108057291), mRNA.
ACCESSION   XM_017141491
VERSION     XM_017141491.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141491.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1098
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1098
                     /gene="LOC108057291"
                     /note="delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase,
                     mitochondrial; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108057291"
     CDS             87..1046
                     /gene="LOC108057291"
                     /codon_start=1
                     /product="delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase,
                     mitochondrial"
                     /protein_id="XP_016996980.2"
                     /db_xref="GeneID:108057291"
                     /translation="MSLSRLNTLMKLAPQSAAAASTVMRSPQRNLSAQSQPESGVTGG
                     HHFKTLAISSPKPFVFHVELHRPNKFNAINKQMWLEIKECIDGLAINPDCRAIVVSAA
                     GKHFTAGIDLNDMMNLGQTLAETDDYARKGVVLERMIKLYQDSISSLELCPKPVITAV
                     HKACIGAGVDLITASDIRYATEDAFFQVKEVDIGMAADVGTLQRLPKAVGSQSLAREL
                     CYTGRKFEASEAHSSGLVSRLFPDKESLLSGALALAEQIASKSPIAVKTTKESIVYSL
                     EHTNQEGLDHIRLLNKLNLLSEDFAQAVAAQLTKDEKPVFAKL"
     misc_feature    261..1037
                     /gene="LOC108057291"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cl23717"
                     /db_xref="CDD:474030"
     misc_feature    order(294..296,300..302,396..398,408..422,573..575,
                     579..587,651..656,663..665)
                     /gene="LOC108057291"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(414..416,585..587)
                     /gene="LOC108057291"
                     /note="oxyanion hole (OAH) forming residues [active]"
                     /db_xref="CDD:119339"
     misc_feature    order(525..527,549..551,612..623,657..668,684..686,
                     690..698,702..707,723..728,732..737,741..746,753..755,
                     786..788,795..797,843..845,852..857)
                     /gene="LOC108057291"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     polyA_site      1098
                     /gene="LOC108057291"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cccgccattt atcgataaac aaacaacgac taatttcgca gccgcaacaa gtggatttta
       61 tttgaaatag ttatttttct ataattatgt cgctctcccg actgaacaca ctgatgaagc
      121 tggcacccca atcggcagct gccgcctcca ccgtcatgcg atctccccag cggaacctct
      181 ccgcccaatc ccagccagaa tccggggtca ccggtggcca ccatttcaaa accctggcca
      241 tcagttcacc caaacccttc gtcttccatg tggagctgca tcgtcccaac aaattcaatg
      301 ccatcaacaa gcagatgtgg ctggagatca aggagtgcat cgatggactg gccattaatc
      361 cggattgccg tgccattgtg gtttccgctg cgggcaagca ttttaccgcc ggaatcgatc
      421 tgaatgacat gatgaacctg ggccaaacgc tggccgagac ggatgactat gcccgcaagg
      481 gcgtcgtttt ggagcgcatg atcaagctgt accaggattc gattagcagt ctggaactct
      541 gccccaaacc ggtgatcaca gcggttcaca aggcttgtat aggagcagga gtcgatctga
      601 ttaccgcctc cgacattcgc tacgccaccg aggacgcctt cttccaggtg aaggaggtgg
      661 acatcggcat ggccgccgat gtgggcaccc tgcagcgtct gcccaaggcg gtgggcagtc
      721 aatctttggc ccgcgagctc tgctacacgg gtcgcaagtt cgaggcgtcg gaggcccatt
      781 cctcgggcct cgtgagtcgc ctctttcccg acaaggagtc cctgctcagc ggcgccttgg
      841 ctctggccga gcagatagcc agcaaaagtc ccattgccgt gaagaccact aaggagagca
      901 tcgtctactc gctggagcac accaatcagg agggtttgga tcacattcgc ctgctgaaca
      961 agctgaacct gctgtcggag gactttgccc aggccgtggc cgcccaattg accaaggacg
     1021 agaagcccgt gttcgccaag ctgtgattta ccatgtattt acaatctaaa atacaccagc
     1081 tgcctttatg actaggaa