Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii xaa-Pro aminopeptidase 3


LOCUS       XM_017141490            1787 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108057290), mRNA.
ACCESSION   XM_017141490
VERSION     XM_017141490.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141490.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1787
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1787
                     /gene="LOC108057290"
                     /note="xaa-Pro aminopeptidase 3; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108057290"
     CDS             114..1727
                     /gene="LOC108057290"
                     /codon_start=1
                     /product="xaa-Pro aminopeptidase 3"
                     /protein_id="XP_016996979.2"
                     /db_xref="GeneID:108057290"
                     /translation="MNVLRRLDRLLAPSARRRAVVSTCLWPRRSQTTTSSSGNPSSSG
                     NPISNATVNAAEVRGVAQILRQQQGNLGQPTSVSHPHLIRPEELVPGVELAEIKERRA
                     QLMQNIRAYARSFGGEFNGHSSPNHMFVLGAGTKKYMSGKIPYVFRQNSDFYYLTGCL
                     EPEAVLLLTIDEAQNVQSELFMLPKDAHAELWDGPRTGPELAVPLFGVTEAHPLSKLQ
                     AVLEKRAAALKPHIWFDQKTSDLPSLAENMLRLSGSQQRPLLPAYTFIEAMRLLKSRA
                     EMQLMRRTCDIASRSFNELMAETRPGQSEHHLFAAIDYKCRMRNASHLAYPPVVAAGR
                     NATVIHYVSNSQLIGPEDMVLMDAGCEYGGYTSDITRTWPASGRFTDAQRTLYEMLHQ
                     LQGEIIANVMQPGGETLDQLFETTCYKLGKYLQEIGLVGKSVSDYKELAGQGYRFCPH
                     HVSHYLGMDVHDTPHVPRNTRIVPGMVFTVEPGIYIGQDCGDVPPEFRGLGLRIEDDL
                     LVNERGQVEVLTQGCVKEPRELQALSSNS"
     misc_feature    405..812
                     /gene="LOC108057290"
                     /note="Aminopeptidase P, N-terminal domain; Region: AMP_N;
                     pfam05195"
                     /db_xref="CDD:461581"
     misc_feature    945..1673
                     /gene="LOC108057290"
                     /note="E.C. 3.4.13.9. Also known as Xaa-Pro dipeptidase,
                     X-Pro dipeptidase, proline dipeptidase., imidodipeptidase,
                     peptidase D, gamma-peptidase. Catalyses hydrolysis of
                     Xaa-Pro dipeptides; also acts on aminoacyl-hydroxyproline
                     analogs. No action on Pro-Pro; Region: Prolidase; cd01087"
                     /db_xref="CDD:238520"
     misc_feature    order(1131..1133,1182..1184,1215..1217,1473..1475,
                     1554..1556,1626..1628)
                     /gene="LOC108057290"
                     /note="active site"
                     /db_xref="CDD:238520"
     polyA_site      1787
                     /gene="LOC108057290"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agcgatctgg caacctttgc ccgttttgtt tttattccgt tttcgccttg ttattgttat
       61 tcgattggat ttcttatgtg gaatttgtag attttaaagc aaccggccgc acgatgaatg
      121 tcctgaggcg cctggaccgc ctcctcgcac cttccgcccg ccgccgcgcc gtcgtctcca
      181 cgtgcctgtg gccccgcagg agccaaacga ccacgagctc ctctggaaat cccagctcct
      241 ccgggaatcc gatctccaat gccaccgtga acgccgccga ggtgcgcggc gtggcgcaga
      301 ttcttcgcca gcagcagggc aacctgggcc agcccaccag cgtctcgcat ccgcatctca
      361 tccggccgga ggagctggtt cccggcgtgg agctggccga gatcaaggag cgccgtgcgc
      421 agctcatgca aaacatacgc gcctatgcgc gcagctttgg cggcgagttc aacggccact
      481 cgagtcccaa tcacatgttc gttttgggcg ctggaaccaa gaaatacatg agcggcaaga
      541 tcccctatgt attccgtcag aactcggact tttactacct caccggctgc ctggaaccgg
      601 aggccgtgct cctgctgacc atcgacgagg cccagaacgt ccagtccgag ctgtttatgc
      661 tgcccaagga tgcgcatgct gagctgtggg atggtccacg aacgggacct gaactggcgg
      721 ttcccctctt cggcgtcacg gaggcacatc cgttgtccaa gctccaggcg gtgctggaga
      781 agcgagccgc ggccttgaaa ccccacattt ggttcgacca gaagaccagt gaccttccct
      841 cgctagccga aaacatgctg cgtttgagcg gctcccagca gcgtcccctg ctgcccgcct
      901 acacttttat agaggccatg cgactgctca aatcccgcgc cgaaatgcag ctaatgcgtc
      961 gcacctgcga catagcctcg cgctccttca acgagctgat ggcggagacg cgaccgggcc
     1021 aatcggagca tcacctgttc gccgccatcg actacaagtg ccgcatgcgc aacgccagcc
     1081 atttggccta tccgccggtg gtggccgccg gcaggaatgc cactgtaatt cactacgtaa
     1141 gcaatagcca gttgattgga cccgaggata tggtgctaat ggatgcgggc tgcgagtatg
     1201 gcggctacac gagcgacata acgcgcactt ggccggccag tggtcgcttt acggatgccc
     1261 agcgaacgct ctacgagatg ctgcaccagc tgcagggcga aatcattgcg aatgtgatgc
     1321 aaccgggcgg cgagaccctc gatcagttgt tcgaaaccac ctgctacaag ttgggaaagt
     1381 atctgcagga aatcggactg gtcggcaagt cggtgagcga ctacaaggag ctggccggcc
     1441 agggatatcg cttctgtccg caccacgtct cccactacct gggcatggat gtccacgata
     1501 cgccgcatgt gccgcgcaac acgaggattg tgcccggcat ggtcttcacc gtggagccgg
     1561 gcatctatat tggccaggat tgcggcgatg tgccgcccga attccgcggc ctgggcctgc
     1621 gcatcgagga cgatctgctg gtcaacgagc gcggccaggt ggaggtgcta acgcagggct
     1681 gcgtcaagga gccgcgcgaa ttgcaggcac tatcatcgaa ttcctagtca taaaggcagc
     1741 tggtgtattt tagattgtaa atacatggta aatcacagct tggcgaa