Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141478 1996 bp mRNA linear INV 09-DEC-2024 (Rab10), mRNA. ACCESSION XM_017141478 VERSION XM_017141478.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141478.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1996 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1996 /gene="Rab10" /note="RAS oncogene family member Rab10; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins" /db_xref="GeneID:108057281" CDS 274..888 /gene="Rab10" /codon_start=1 /product="ras-related protein Rab-10" /protein_id="XP_016996967.1" /db_xref="GeneID:108057281" /translation="MAKKTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGI DFKIKTVELRGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVK WLRNIDEHANEDVEKMILGNKCDMTDKRVVNKERGEAIAREHGIRFMETSAKSNINIE RAFCELAEAILDKTSGRESAENPERVIIDRRNQEKAPGYSKCCA" misc_feature 292..792 /gene="Rab10" /note="Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13); Region: Rab8_Rab10_Rab13_like; cd01867" /db_xref="CDD:206659" misc_feature 292..306 /gene="Rab10" /note="Rab subfamily motif 1 (RabSF1); other site" /db_xref="CDD:206659" misc_feature 319..342 /gene="Rab10" /note="G1 box; other site" /db_xref="CDD:206659" misc_feature order(325..345,373..384,391..396,472..474,637..642, 646..651,730..735) /gene="Rab10" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206659" misc_feature order(343..381,385..393) /gene="Rab10" /note="Rab subfamily motif 2 (RabSF2); other site" /db_xref="CDD:206659" misc_feature order(373..375,388..414) /gene="Rab10" /note="Switch I region; other site" /db_xref="CDD:206659" misc_feature order(382..384,388..390,400..423,442..444,448..450) /gene="Rab10" /note="GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:206659" misc_feature 394..396 /gene="Rab10" /note="G2 box; other site" /db_xref="CDD:206659" misc_feature order(397..399,403..411,454..456,460..462,481..486, 493..495,505..507,511..522,781..783) /gene="Rab10" /note="putative effector interaction site [active]" /db_xref="CDD:206659" misc_feature order(397..402,406..408,460..465,484..486,490..492, 496..504) /gene="Rab10" /note="putative GDI interaction site [polypeptide binding]; other site" /db_xref="CDD:206659" misc_feature 397..411 /gene="Rab10" /note="Rab family motif 1 (RabF1); other site" /db_xref="CDD:206659" misc_feature 448..462 /gene="Rab10" /note="Rab family motif 2 (RabF2); other site" /db_xref="CDD:206659" misc_feature 463..474 /gene="Rab10" /note="G3 box; other site" /db_xref="CDD:206659" misc_feature order(472..474,478..510) /gene="Rab10" /note="Switch II region; other site" /db_xref="CDD:206659" misc_feature 481..498 /gene="Rab10" /note="Rab family motif 3 (RabF3); other site" /db_xref="CDD:206659" misc_feature 505..519 /gene="Rab10" /note="Rab family motif 4 (RabF4); other site" /db_xref="CDD:206659" misc_feature 532..549 /gene="Rab10" /note="Rab family motif 5 (RabF5); other site" /db_xref="CDD:206659" misc_feature 601..630 /gene="Rab10" /note="Rab subfamily motif 3 (RabSF3); other site" /db_xref="CDD:206659" misc_feature 637..648 /gene="Rab10" /note="G4 box; other site" /db_xref="CDD:206659" misc_feature 727..735 /gene="Rab10" /note="G5 box; other site" /db_xref="CDD:206659" misc_feature 775..792 /gene="Rab10" /note="Rab subfamily motif 4 (RabSF4); other site" /db_xref="CDD:206659" polyA_site 1996 /gene="Rab10" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atgcatcgca tgtatcgcat tgaaagcgaa aatataaagt aattcggcgc atttaaaacc 61 cgggaaggag acaagggctt aaaggagaag accagatctc aggctcatta gttaggcgaa 121 ccaaaaacga ggaaaatcgc gggaagggca ggcgcttaaa taatagtatc gtttgtcacc 181 tgcatccgtg cgtgtgtgtg tgtgtgtgcg agtgtagtgt gcgtgcgtgc gtgtgtttgt 241 gctttgttct gcgagcgttt cgttttggtg gaaatggcaa agaaaaccta cgatttgctc 301 ttcaaactgt tgctgatcgg cgactcggga gtgggaaaga cgtgcatatt gttccgattc 361 tcggatgatg cctttacctc cacgtttata tcgaccatag gcatcgattt caaaatcaaa 421 acagtcgagc tgcgcggcaa gaagatcaag ctgcaaatat gggataccgc cggtcaggag 481 cgattccaca cgataaccac ctcgtattat aggggcgcca tgggcataat gctcgtctat 541 gacataacga acgagaagag tttcgagaat atagtcaaat ggttgcggaa tatagacgag 601 cacgccaacg aggatgtgga gaaaatgatc ctgggcaaca agtgcgacat gacggacaag 661 cgagtggtca acaaggagcg cggcgaagcg attgcccgtg aacacggcat tcggtttatg 721 gaaacatccg ccaaatcgaa cataaacatc gagcgggcct tctgcgagct ggccgaggcc 781 attctggaca agacatcggg ccgcgagtcg gcggagaatc cggagcgcgt gatcatcgat 841 cgccggaacc aggagaaggc gccgggctac agcaagtgct gtgcgtaaaa ggcggctcaa 901 caggcgaacg gggcgtggtt taacccggtt tgtgcttgga tggattcgga attggattgg 961 attggattga atggagtggg gatcggtttc tgaaactgct ccgcacaaaa cgagagaggg 1021 gaaacaaagc aataaacccg gggtcaatcg cacggaggga acatacttat aacgagtata 1081 cgcagatagc agatggaaca agaacaacag cagcagaaac aacctaccta aagtttaaca 1141 acagatattg taatacgaac atttggaagc aactttacaa aacgaaaaaa aacaccccgt 1201 atccggatgt ggtggtcaga taacagatgg aatggtcaga ggatcacaag atcagttcca 1261 gccacacgaa acgattaaga taacaaagac gcagacataa gcaacttttg taacgtaact 1321 tttgatatat atatagtctt acgatccctg ttcgttcgcc atcactcgca cttcttaaac 1381 caactatccc agccccgctt agtgttttgt tttgttttgc gtttcagcct agatataaat 1441 aacacctata catattatac atcggatagt atatagccta tacataccta gcttgctttc 1501 gctttgtttt ctgtcgatac taagccggcg atactaggat ttcgatcggg ggaggtaggg 1561 gatccataga tgctctgcag tcactcatcc aagccagagt ctgttccgaa attgttttct 1621 gattattgcc tatatatata tatataaata ccatatatat tgcatcgttt ttatgtgcat 1681 ccgcgcgccc gcacactcaa tatatatatg tgtacactta agggggcgtg ggtgtgcgcg 1741 cgtgtatatc tccatgttgt gtatgtaagg acggtgcacg ccatgaatgt agtagcaaaa 1801 ccgcaggaga ggaggagcgg cgcccccaaa aaaaacccaa cgcctcctgc ctgtctcctt 1861 gtaattttat tctacatctt ttttttgttc gtgtaaacca attatttgta actgtatatg 1921 gatttagttt agttgtctac accaaatgat ttaccgatta aaaatataaa gaacaaccta 1981 aaccatgtca tataaa