PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017141436             753 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108057261), mRNA.
ACCESSION   XM_017141436
VERSION     XM_017141436.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141436.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..753
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..753
                     /gene="LOC108057261"
                     /note="uncharacterized LOC108057261; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108057261"
     CDS             126..698
                     /gene="LOC108057261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016996925.2"
                     /db_xref="GeneID:108057261"
                     /translation="MLVIGALVNLLLISACVYAMYSLTPADHPYGYLAASFSLVHGLL
                     GLVRSYSEEPDECGRTFMISASILEVIPLPLANIEFYMVSDQSGVALVHGLSLIPLFY
                     DMIGKMGDDWDSSTETLKDLALLGNIGSTLYLALKDGNHLYGGVAATAFVARYGAALV
                     DRFIEGSGAHVATLGNAGILALMTYALTEG"
     misc_feature    198..683
                     /gene="LOC108057261"
                     /note="Domain of unknown function (DUF4791); Region:
                     DUF4791; pfam16039"
                     /db_xref="CDD:406447"
ORIGIN      
        1 cttcagtcat tgtcatcgtt tcaagcaagc aacattccaa attctcagta ttagcgttcg
       61 gacaaaaaaa aagtgattct acagatcgtg atatttaagt gataaaatcg aggaaaagcc
      121 gaaacatgct tgtgattggg gctctggtca atctgctgct catctcggcc tgcgtctacg
      181 cgatgtactc gctgaccccg gcggaccatc cgtacggcta tttggcggca tcatttagcc
      241 tggtccacgg cctgctgggc ctggtgcgct cctactcgga ggagcccgac gagtgcggac
      301 gcaccttcat gatctcggcc agcattctgg aggtcatccc gctgccactg gccaacatcg
      361 agttctacat ggtatccgat caatcgggag tggcgctggt gcacggcctc tcgttgattc
      421 cgctcttcta cgacatgatc ggcaagatgg gcgacgactg ggacagctcc acggagacgt
      481 tgaaggatct ggcgctgctg ggcaacattg ggtccaccct gtacctggcc ctcaaggatg
      541 ggaatcatct ctacggcggt gtggctgcca ccgcattcgt ggcccgatat ggggcagctc
      601 tggtcgatcg cttcatcgag ggctctggcg cccacgtggc cacactgggc aacgccggaa
      661 tcctggccct tatgacctac gcactcaccg agggttgatt gcttagactt caaattaact
      721 attcgcggaa taaaaggaaa aattcaacta aat