Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017141434            1427 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108057260), mRNA.
ACCESSION   XM_017141434
VERSION     XM_017141434.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141434.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1427
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1427
                     /gene="LOC108057260"
                     /note="uncharacterized LOC108057260; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108057260"
     CDS             131..1270
                     /gene="LOC108057260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016996923.2"
                     /db_xref="GeneID:108057260"
                     /translation="MSDLNECALDRHFTAQLRDLRSYSKEHPVSQEDFEISQRWMNHF
                     KEARGHDKFARNCLMLLLCNQLREIGHLTKPFTEMESMNRPLDDLVNEYKAKTVEDQQ
                     PADDDDDEISNSSCYQEVAAEEPLPSPRFESIKQANQNLLREIESLHSRAVETEKLYR
                     SRNQVLAKKMAEKSKTGKPEFVQENLNQACRSAIGLLKDWPGETVRLHFLATCLEPLL
                     RNELVVSSQIAELDIKLEDTLNSLVLQACTRRDDNVRMLYEHVLTHDKFGLREKEEKL
                     RRFHESLRQERQRLRLLSEDLRRREDLIWRHQAIATLAVTGLPAENPGSPGHSRCDLC
                     QGERSFRPGTEHPPTSGTRNSKKSEGAEDLQKLTETLSDLSADKW"
     polyA_site      1427
                     /gene="LOC108057260"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attatttgta aaccttttct acctattgat caactctctc ttctcgtcca caaaaaaata
       61 aatttaaaac aaaaaaaaaa cacaaaaatc aaatcgaaat tccgaaagac ttacagaacg
      121 gtttaaaaca atgagcgacc ttaatgagtg cgccctggat cgccacttca ctgcccagtt
      181 gcgcgatctg cgatcctact cgaaggagca cccagtcagc caggaggact ttgaaattag
      241 ccagcgctgg atgaatcact tcaaggaggc caggggccat gacaagttcg cccggaactg
      301 cctgatgttg ttgttgtgca accagctgcg ggaaattggt cacctgacca agcccttcac
      361 cgaaatggag agcatgaacc ggcccctgga tgatttggtc aacgagtaca aggcgaagac
      421 agtggaggac cagcagccag cggatgatga tgatgatgag atctcgaact cttcctgcta
      481 ccaggaagtg gccgccgagg agccccttcc ctctccccga ttcgagagca ttaaacaggc
      541 gaatcagaat ctcctcaggg agatcgagtc gctgcacagc cgcgccgtgg aaacggagaa
      601 gctctacaga agccgaaatc aagtgctggc caagaagatg gccgaaaagt ccaaaacagg
      661 aaaaccggag ttcgttcagg agaatctaaa tcaggcctgc cgatcggcca ttggactgtt
      721 gaaggattgg cccggcgaaa ccgtgcgtct ccatttcctg gccacctgcc tggagcctct
      781 tttgcgaaac gaactggtgg tcagttcaca gattgccgag ctcgatatca agttggagga
      841 cactttgaac agcctggtcc tgcaggcctg tacacgtagg gacgacaatg ttcgcatgct
      901 ctacgagcac gttttgaccc acgacaaatt tggtttaagg gaaaaggagg aaaagctgcg
      961 ccgctttcac gaatccttga ggcaggagcg tcagagactg cggctgcttt ccgaggatct
     1021 gaggcggcgc gaggatctca tttggaggca ccaggccatt gccaccttgg cggttactgg
     1081 acttccggcc gaaaaccccg gcagtcccgg ccactcaaga tgcgatttgt gtcaggggga
     1141 aagatccttt agaccgggaa cggaacatcc cccgacttct gggactcgca attcgaagaa
     1201 atccgaaggc gccgaagatc tgcaaaagct aaccgagaca ctcagcgatc tgtccgctga
     1261 caaatggtaa tccatccacg ataacataac acgctgccca cccactttcc catatatatt
     1321 tttcattttc ttgttcaaat caataaatcg ttgagctgtt ttgaaaagtt ctaccgggga
     1381 gcagaggtcc tcacttttga ccgcctgcgt ccctgccaac tgcaaaa