Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141432 637 bp mRNA linear INV 09-DEC-2024 (Obp19b), mRNA. ACCESSION XM_017141432 VERSION XM_017141432.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141432.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..637 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..637 /gene="Obp19b" /note="Odorant-binding protein 19b; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:108057258" CDS 11..499 /gene="Obp19b" /codon_start=1 /product="general odorant-binding protein 19d" /protein_id="XP_016996921.1" /db_xref="GeneID:108057258" /translation="MMQSNRLTMTMTNLLMALACAGVLMGSGASAEEEEVSMTVDEVV ELIEPFGDGCTPKPLRENIVEMVLNKEDAKLETKCFRHCMLEQFELMPEGQLQFSEDK TVEMINMMFPDREEDGRRIIKICNEEKKAEKDKCEAAHGITMCMLREMRSSGFKIPEI KE" misc_feature 122..457 /gene="Obp19b" /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395" /db_xref="CDD:460193" misc_feature order(251..253,263..265,281..283,425..427,446..448) /gene="Obp19b" /note="ligand binding site [chemical binding]; other site" /db_xref="CDD:467938" polyA_site 637 /gene="Obp19b" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agaggcgaaa atgatgcaga gcaaccggct aacgatgacg atgacgaacc tcctgatggc 61 actggcctgc gccggtgtgc tgatgggatc gggagcctcg gcggaggagg aggaggtctc 121 catgaccgtc gacgaggtgg tggagctgat cgagcccttc ggcgacggct gcaccccgaa 181 accgttgcgg gagaacatcg tcgagatggt gctgaacaag gaggacgcca agctcgagac 241 caagtgcttc cgccactgca tgctggagca gttcgagctg atgcccgagg gccagttgca 301 gttcagcgag gacaagaccg tcgagatgat caacatgatg ttcccggatc gcgaggagga 361 tggccggcgc atcatcaaga tctgcaacga ggagaagaag gcggagaagg acaagtgcga 421 ggctgcccac ggcatcacca tgtgcatgct ccgcgagatg cgctcctccg gcttcaagat 481 tcccgaaatc aaggagtgag ttggatgagc tgccctctaa attgcatgtt ctccattctt 541 tttttttctg tgtgttagtt cagttcaatt taattagaaa cagctcgaga atttggggtg 601 gttcccaaca caaataaagc gcccaaccaa cgaaaaa