Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Odorant-binding protein 19b


LOCUS       XM_017141432             637 bp    mRNA    linear   INV 09-DEC-2024
            (Obp19b), mRNA.
ACCESSION   XM_017141432
VERSION     XM_017141432.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141432.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..637
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..637
                     /gene="Obp19b"
                     /note="Odorant-binding protein 19b; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 14
                     Proteins"
                     /db_xref="GeneID:108057258"
     CDS             11..499
                     /gene="Obp19b"
                     /codon_start=1
                     /product="general odorant-binding protein 19d"
                     /protein_id="XP_016996921.1"
                     /db_xref="GeneID:108057258"
                     /translation="MMQSNRLTMTMTNLLMALACAGVLMGSGASAEEEEVSMTVDEVV
                     ELIEPFGDGCTPKPLRENIVEMVLNKEDAKLETKCFRHCMLEQFELMPEGQLQFSEDK
                     TVEMINMMFPDREEDGRRIIKICNEEKKAEKDKCEAAHGITMCMLREMRSSGFKIPEI
                     KE"
     misc_feature    122..457
                     /gene="Obp19b"
                     /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395"
                     /db_xref="CDD:460193"
     misc_feature    order(251..253,263..265,281..283,425..427,446..448)
                     /gene="Obp19b"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:467938"
     polyA_site      637
                     /gene="Obp19b"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agaggcgaaa atgatgcaga gcaaccggct aacgatgacg atgacgaacc tcctgatggc
       61 actggcctgc gccggtgtgc tgatgggatc gggagcctcg gcggaggagg aggaggtctc
      121 catgaccgtc gacgaggtgg tggagctgat cgagcccttc ggcgacggct gcaccccgaa
      181 accgttgcgg gagaacatcg tcgagatggt gctgaacaag gaggacgcca agctcgagac
      241 caagtgcttc cgccactgca tgctggagca gttcgagctg atgcccgagg gccagttgca
      301 gttcagcgag gacaagaccg tcgagatgat caacatgatg ttcccggatc gcgaggagga
      361 tggccggcgc atcatcaaga tctgcaacga ggagaagaag gcggagaagg acaagtgcga
      421 ggctgcccac ggcatcacca tgtgcatgct ccgcgagatg cgctcctccg gcttcaagat
      481 tcccgaaatc aaggagtgag ttggatgagc tgccctctaa attgcatgtt ctccattctt
      541 tttttttctg tgtgttagtt cagttcaatt taattagaaa cagctcgaga atttggggtg
      601 gttcccaaca caaataaagc gcccaaccaa cgaaaaa