Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii leaky (lky), mRNA.


LOCUS       XM_017141431            1264 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017141431
VERSION     XM_017141431.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141431.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1264
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1264
                     /gene="lky"
                     /note="leaky; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108057256"
     CDS             181..1050
                     /gene="lky"
                     /codon_start=1
                     /product="alpha-tubulin N-acetyltransferase 2"
                     /protein_id="XP_016996920.2"
                     /db_xref="GeneID:108057256"
                     /translation="MVEFAFDIKHLFPQPIIRVQAHSLRPKVAATAGRINPLIPHYRQ
                     RINHQSAVGPKCQLSQILDAMGQLSAVAQGLRQPVTTAEKLAPDQVVYLMADHEAGRW
                     SVAGLLKVGTKDLFLFDKQGSCRRADKTPAILDFYVHESRQRRGLGKQLFERMLDEQG
                     WLASKCSVDRPSEKLLAFLGKHYGLVSTIPQGNNFVLYEGFFEDTSGRISSARNRMAN
                     GNRARSQSQGHHLRRTQMQMQQQVQQQQQNYNPRHHRRDILNQGQGQDWDAPRTFASM
                     DHIQGSRARRSHH"
     misc_feature    205..786
                     /gene="lky"
                     /note="GNAT acetyltransferase, Mec-17; Region:
                     Acetyltransf_16; pfam05301"
                     /db_xref="CDD:461616"
ORIGIN      
        1 acctgaatgc ccccagccaa ggcatcagta tcaaaaatcg tgctgtgttt gttcgggcga
       61 gtagaaaaag tatgagaaaa atttcagaag ttgtggctgc tgcgtaagaa tcgctactgg
      121 tactccctgg caaacagatc tccgtgctcg aaaactaaga ggctaaaacc accgatcaag
      181 atggtggagt tcgccttcga catcaagcac ctctttccgc agccgatcat ccgggtgcag
      241 gcccactcgc tgcgccccaa ggtcgccgcc accgctggac ggattaaccc cctaataccg
      301 cattaccgtc agcgaattaa ccaccagtcg gcggtgggcc ccaagtgcca gctcagccag
      361 atcctggacg ccatgggcca gctgtcggcg gtggcccagg gactgcgtca gccggtgacc
      421 accgccgaga agctggcgcc cgaccaggtg gtctacctga tggccgacca cgaggcggga
      481 cgctggagcg tcgccgggct gctcaaggtc ggcaccaagg acctcttcct gttcgacaag
      541 cagggctcct gccgtcgggc cgacaagacg ccggccatcc tcgacttcta cgtccacgag
      601 tcgcgccagc gtcgcggttt gggcaagcag ctcttcgaga gaatgctcga cgaacagggc
      661 tggctggcca gcaagtgctc cgtggaccgg ccgtccgaga agctgctggc cttcctgggc
      721 aaacactacg gcctggtcag caccattccg cagggcaaca atttcgttct ctacgagggc
      781 ttcttcgagg acaccagcgg caggatctcc tcggcccgca atcgaatggc gaatggcaac
      841 agggctcgca gccaaagtca gggtcaccat ctccgccgga cgcagatgca gatgcagcag
      901 caggtgcagc agcagcagca gaattacaat cccagacacc accgacggga catcctcaac
      961 cagggacagg gacaggactg ggacgcacca cgcaccttcg ccagcatgga ccacatccag
     1021 ggctccaggg ccaggagatc ccaccactag gactccggac tactactact tagatgcacc
     1081 ttcacaccta cactcgttcc catttggagc actcaccgca caccaaattt ctagttgatg
     1141 tttaaatttt aaaggttttt atctgttttt gccatacaac ccatccagaa aaagactaaa
     1201 caaaaaacta cgtaaatttc atgatgtaaa ttccaaatgc agttgcggca aaaaaaatta
     1261 aaaa