Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Odorant-binding protein 19c


LOCUS       XM_017141430             775 bp    mRNA    linear   INV 09-DEC-2024
            (Obp19c), mRNA.
ACCESSION   XM_017141430
VERSION     XM_017141430.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141430.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..775
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..775
                     /gene="Obp19c"
                     /note="Odorant-binding protein 19c; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:108057255"
     CDS             40..561
                     /gene="Obp19c"
                     /codon_start=1
                     /product="general odorant-binding protein 19d"
                     /protein_id="XP_016996919.2"
                     /db_xref="GeneID:108057255"
                     /translation="MKPSAILLITSVILGVLLQMHCIQGQKQAFDIAKLLPKTGTEPI
                     WTVIDRNLPQVQEMINTARTECIQKLQLPRDQRPLMKVANPSEKEKCLSECVLKKIKL
                     MDENNKLNLSQVEKLTSLVTQDNKVAIAVSSSMASACNRGISSRSNSCEAAHLFNQCI
                     GRQLERSNVKLVW"
     misc_feature    order(214..216,316..318,328..330,346..348,496..498,
                     517..519)
                     /gene="Obp19c"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:467938"
     misc_feature    223..519
                     /gene="Obp19c"
                     /note="Insect pheromone/odorant binding protein domains;
                     Region: PhBP; smart00708"
                     /db_xref="CDD:214783"
     polyA_site      775
                     /gene="Obp19c"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccgatcaagt ggagatccaa agatcaaccc gttgcgaaga tgaaaccatc cgccatttta
       61 ctgataacct ccgtcatcct gggagttttg ctgcagatgc actgcatcca gggccagaaa
      121 caggcctttg atatcgccaa gctgctgccc aagaccggaa cagagcccat ttggacggtg
      181 atcgatcgca atctgccgca ggtgcaggag atgatcaaca cggcgaggac ggagtgcatc
      241 cagaagctcc agctgcccag ggatcagcgg cccctgatga aggtggccaa tcccagcgag
      301 aaggagaagt gcctttcgga gtgtgtgctg aagaagatca agctgatgga cgagaacaac
      361 aagctgaacc tgagccaggt ggagaagctg accagcctgg tgacccagga caacaaggtg
      421 gccatcgccg tcagcagcag catggcctcg gcctgcaacc ggggcatctc ctccaggagc
      481 aactcctgcg aggcagccca cctgttcaac cagtgcatcg gtcgccagtt ggagcggagc
      541 aacgtgaaac tggtgtggta ataataatat agctctgctc tggtgaagat cagttggaat
      601 atcctgaaaa acactcaatt tctattcact aaattgttaa aatgtgaact agaccacaag
      661 aatttcgagc acattattcg ttaaaatgat tccaaaaata ttttaaataa ttattataat
      721 cataagctgt gggcttgcaa tattatatta ataaaactta taaatacgaa aatta