Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141430 775 bp mRNA linear INV 09-DEC-2024 (Obp19c), mRNA. ACCESSION XM_017141430 VERSION XM_017141430.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141430.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..775 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..775 /gene="Obp19c" /note="Odorant-binding protein 19c; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:108057255" CDS 40..561 /gene="Obp19c" /codon_start=1 /product="general odorant-binding protein 19d" /protein_id="XP_016996919.2" /db_xref="GeneID:108057255" /translation="MKPSAILLITSVILGVLLQMHCIQGQKQAFDIAKLLPKTGTEPI WTVIDRNLPQVQEMINTARTECIQKLQLPRDQRPLMKVANPSEKEKCLSECVLKKIKL MDENNKLNLSQVEKLTSLVTQDNKVAIAVSSSMASACNRGISSRSNSCEAAHLFNQCI GRQLERSNVKLVW" misc_feature order(214..216,316..318,328..330,346..348,496..498, 517..519) /gene="Obp19c" /note="ligand binding site [chemical binding]; other site" /db_xref="CDD:467938" misc_feature 223..519 /gene="Obp19c" /note="Insect pheromone/odorant binding protein domains; Region: PhBP; smart00708" /db_xref="CDD:214783" polyA_site 775 /gene="Obp19c" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccgatcaagt ggagatccaa agatcaaccc gttgcgaaga tgaaaccatc cgccatttta 61 ctgataacct ccgtcatcct gggagttttg ctgcagatgc actgcatcca gggccagaaa 121 caggcctttg atatcgccaa gctgctgccc aagaccggaa cagagcccat ttggacggtg 181 atcgatcgca atctgccgca ggtgcaggag atgatcaaca cggcgaggac ggagtgcatc 241 cagaagctcc agctgcccag ggatcagcgg cccctgatga aggtggccaa tcccagcgag 301 aaggagaagt gcctttcgga gtgtgtgctg aagaagatca agctgatgga cgagaacaac 361 aagctgaacc tgagccaggt ggagaagctg accagcctgg tgacccagga caacaaggtg 421 gccatcgccg tcagcagcag catggcctcg gcctgcaacc ggggcatctc ctccaggagc 481 aactcctgcg aggcagccca cctgttcaac cagtgcatcg gtcgccagtt ggagcggagc 541 aacgtgaaac tggtgtggta ataataatat agctctgctc tggtgaagat cagttggaat 601 atcctgaaaa acactcaatt tctattcact aaattgttaa aatgtgaact agaccacaag 661 aatttcgagc acattattcg ttaaaatgat tccaaaaata ttttaaataa ttattataat 721 cataagctgt gggcttgcaa tattatatta ataaaactta taaatacgaa aatta