Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141429 458 bp mRNA linear INV 09-DEC-2024 mitochondrial (LOC108057254), mRNA. ACCESSION XM_017141429 VERSION XM_017141429.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141429.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..458 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..458 /gene="LOC108057254" /note="ATP synthase membrane subunit K, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108057254" CDS 127..318 /gene="LOC108057254" /codon_start=1 /product="ATP synthase membrane subunit K, mitochondrial" /protein_id="XP_016996918.1" /db_xref="GeneID:108057254" /translation="MSEQFKFNDVFNSQTMRGRANVAKATWASVGLVYVLVKMHRRNS KRREAKLYCKGCQQALLHG" misc_feature 130..240 /gene="LOC108057254" /note="ATP synthase regulation; Region: ATP_synth_reg; pfam14960" /db_xref="CDD:434349" ORIGIN 1 tgagtgacgt tacttaaaat tccgattgaa accacaatcc gaaacctggt caaaaataaa 61 ggtcgaatat cgtatccaaa tttaaatatt tttccgccga atcaatcagt ccacaacgaa 121 ccgaagatgt ccgaacagtt caagtttaac gacgtcttca atagtcaaac aatgcgcggc 181 cgcgccaatg tagccaaggc cacctgggcc tcggtgggcc tggtctatgt cctggtcaag 241 atgcatcggc gcaactcgaa gcgtcgcgag gcgaagctct actgcaaggg ctgccagcag 301 gctttgttgc acggctagag gatacttgat gccaactatt ccagccccgt gtgtccgtac 361 tcctccgatc cgtcaaagaa tccagttccc agtcccccag ttaaaagcac agtcccaagc 421 ctcgtgtact ttgttgagtc aaataaattt aaaatctc