Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ATP synthase membrane subunit K,


LOCUS       XM_017141429             458 bp    mRNA    linear   INV 09-DEC-2024
            mitochondrial (LOC108057254), mRNA.
ACCESSION   XM_017141429
VERSION     XM_017141429.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141429.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..458
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..458
                     /gene="LOC108057254"
                     /note="ATP synthase membrane subunit K, mitochondrial;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 Proteins"
                     /db_xref="GeneID:108057254"
     CDS             127..318
                     /gene="LOC108057254"
                     /codon_start=1
                     /product="ATP synthase membrane subunit K, mitochondrial"
                     /protein_id="XP_016996918.1"
                     /db_xref="GeneID:108057254"
                     /translation="MSEQFKFNDVFNSQTMRGRANVAKATWASVGLVYVLVKMHRRNS
                     KRREAKLYCKGCQQALLHG"
     misc_feature    130..240
                     /gene="LOC108057254"
                     /note="ATP synthase regulation; Region: ATP_synth_reg;
                     pfam14960"
                     /db_xref="CDD:434349"
ORIGIN      
        1 tgagtgacgt tacttaaaat tccgattgaa accacaatcc gaaacctggt caaaaataaa
       61 ggtcgaatat cgtatccaaa tttaaatatt tttccgccga atcaatcagt ccacaacgaa
      121 ccgaagatgt ccgaacagtt caagtttaac gacgtcttca atagtcaaac aatgcgcggc
      181 cgcgccaatg tagccaaggc cacctgggcc tcggtgggcc tggtctatgt cctggtcaag
      241 atgcatcggc gcaactcgaa gcgtcgcgag gcgaagctct actgcaaggg ctgccagcag
      301 gctttgttgc acggctagag gatacttgat gccaactatt ccagccccgt gtgtccgtac
      361 tcctccgatc cgtcaaagaa tccagttccc agtcccccag ttaaaagcac agtcccaagc
      421 ctcgtgtact ttgttgagtc aaataaattt aaaatctc