Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141428 1081 bp mRNA linear INV 09-DEC-2024 (LOC108057253), mRNA. ACCESSION XM_017141428 VERSION XM_017141428.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141428.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1081 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1081 /gene="LOC108057253" /note="uncharacterized LOC108057253; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108057253" CDS 106..1020 /gene="LOC108057253" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016996917.2" /db_xref="GeneID:108057253" /translation="MADGFKKYFNGTTINGRANVAKATYATLALLFVIYKMRRGSGKS SSELASGKCSCEADQDPSVNSDIGVYGVDPDCSICRERAERAMTEYDREQQRRSAGED DNGCRDDPPPPPPAPPASGGASGSAPRRKCPCEEPQRRAEGSLKHSSNRARGQQIQPP YQYHQYAQPEAEQVRPASQVMGQVHDAFYRVLRGVVGAVLGNAAVNTSGAGSANDAVA VGVSTDELEEDERDDGQDYENGDESPLKRRTAPRSCVPTSGGQENASGQPEELSREQA GAQAEEQAEYSAFSDGFASGMYFTSDEK" misc_feature <115..219 /gene="LOC108057253" /note="ATP synthase regulation; Region: ATP_synth_reg; pfam14960" /db_xref="CDD:434349" polyA_site 1081 /gene="LOC108057253" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccattcaatc agaccctcgc ccggagacag agcacacaca cctagcaccc ggactcaatt 61 ccagatcccc agttcccaga ttcctagctc ccagagcccc aaacaatggc cgacggcttc 121 aagaagtact tcaatgggac aaccatcaac ggacgcgcta acgtggccaa ggccacatac 181 gccacgttgg ccctgctgtt cgtcatctac aagatgcgcc gcggatccgg caagtcctcc 241 agcgagctgg ccagcggcaa gtgcagctgc gaggcggacc aggatccgtc ggtcaacagc 301 gacataggcg tctatggcgt ggatcccgac tgctccattt gccgggagcg tgcggagcgg 361 gcgatgaccg agtacgatcg cgagcagcag cgccggtcgg cgggtgagga tgacaatggc 421 tgccgggacg atccgccgcc gccgccgcca gcgcctcctg catccggagg agcatccggc 481 tcggctccgc gacgcaagtg tccctgcgag gagccgcagc ggcgtgcaga gggatccctg 541 aagcacagca gcaacagggc gcgtggccag cagatccagc cgccctatca gtaccaccag 601 tacgcgcagc ccgaggcgga gcaagtgcgt ccggccagcc aggtgatggg ccaggtgcac 661 gacgcctttt atcgggtgct gcgaggagtc gttggggctg ttctgggcaa tgcggcggtc 721 aacaccagcg gggcaggtag tgccaacgat gcagtcgcag ttggagtctc tacggatgag 781 ctagaggagg acgagcgaga cgatggtcag gactacgaga acggcgatga gtcgccgctg 841 aagcgccgca ccgctccgcg ctcttgtgtg cccaccagcg gcggccagga gaacgcctcg 901 gggcagccgg aggagctgag ccgggagcag gcaggtgccc aggcggagga gcaggccgag 961 tacagcgcct tcagcgatgg cttcgcctcc gggatgtatt tcaccagcga cgagaagtag 1021 gtggcactat gcctcttggg atctgctaaa tttttagttt aaaataaaaa tgaaaaaagg 1081 a