Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141427 627 bp mRNA linear INV 09-DEC-2024 (Obp19d), mRNA. ACCESSION XM_017141427 VERSION XM_017141427.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141427.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..627 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..627 /gene="Obp19d" /note="Odorant-binding protein 19d; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:108057252" CDS 25..489 /gene="Obp19d" /codon_start=1 /product="general odorant-binding protein 19d" /protein_id="XP_016996916.2" /db_xref="GeneID:108057252" /translation="MSRLVNKSALLLLGLVAMVCLLGAASAKPHEEMTKDHAGELANE CKAETGATDEDVEQMMNHEAPERHEAKCLRACVMKKFQMMDESGKLSKEHAVEMVKAL SKHDAEKEDAPAEVVDKCEAIEAPEDHCDAAVAFENCIYEQMKEHGLELEEH" misc_feature 112..453 /gene="Obp19d" /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395" /db_xref="CDD:460193" misc_feature order(244..246,256..258,274..276,421..423,442..444) /gene="Obp19d" /note="ligand binding site [chemical binding]; other site" /db_xref="CDD:467938" polyA_site 627 /gene="Obp19d" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgcgcagttc aatcgcattt cgaaatgtcg cgtctggtca acaaatccgc tctgctcctc 61 ctgggcctgg tggccatggt gtgcctgctg ggagccgcct ctgccaagcc gcacgaggag 121 atgaccaagg accatgccgg cgagctggcc aacgagtgca aggccgagac gggcgccacc 181 gatgaggatg tggagcagat gatgaaccac gaggcgcccg agagacacga ggccaagtgc 241 ctgcgcgcct gcgtgatgaa gaagttccag atgatggatg agtccggcaa gctgagcaag 301 gagcacgccg tggagatggt caaggcgttg agcaagcacg atgccgagaa ggaggacgcc 361 cccgccgagg tggtggacaa gtgcgaggcc atcgaggcac ccgaggatca ttgcgacgct 421 gccgtcgcct ttgaaaactg catttacgag caaatgaagg agcatggact cgagctggag 481 gaacactgaa caccgatttg attcccattg cgaacccgtt actgcatcac aagcgacccc 541 tctggaatat aaccatctaa ttttttttat gtgtatccta tgactagtct ttaagtaacc 601 gataaagtga gcaactgcaa gagataa