Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Odorant-binding protein 19d


LOCUS       XM_017141427             627 bp    mRNA    linear   INV 09-DEC-2024
            (Obp19d), mRNA.
ACCESSION   XM_017141427
VERSION     XM_017141427.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141427.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..627
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..627
                     /gene="Obp19d"
                     /note="Odorant-binding protein 19d; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins"
                     /db_xref="GeneID:108057252"
     CDS             25..489
                     /gene="Obp19d"
                     /codon_start=1
                     /product="general odorant-binding protein 19d"
                     /protein_id="XP_016996916.2"
                     /db_xref="GeneID:108057252"
                     /translation="MSRLVNKSALLLLGLVAMVCLLGAASAKPHEEMTKDHAGELANE
                     CKAETGATDEDVEQMMNHEAPERHEAKCLRACVMKKFQMMDESGKLSKEHAVEMVKAL
                     SKHDAEKEDAPAEVVDKCEAIEAPEDHCDAAVAFENCIYEQMKEHGLELEEH"
     misc_feature    112..453
                     /gene="Obp19d"
                     /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395"
                     /db_xref="CDD:460193"
     misc_feature    order(244..246,256..258,274..276,421..423,442..444)
                     /gene="Obp19d"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:467938"
     polyA_site      627
                     /gene="Obp19d"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgcgcagttc aatcgcattt cgaaatgtcg cgtctggtca acaaatccgc tctgctcctc
       61 ctgggcctgg tggccatggt gtgcctgctg ggagccgcct ctgccaagcc gcacgaggag
      121 atgaccaagg accatgccgg cgagctggcc aacgagtgca aggccgagac gggcgccacc
      181 gatgaggatg tggagcagat gatgaaccac gaggcgcccg agagacacga ggccaagtgc
      241 ctgcgcgcct gcgtgatgaa gaagttccag atgatggatg agtccggcaa gctgagcaag
      301 gagcacgccg tggagatggt caaggcgttg agcaagcacg atgccgagaa ggaggacgcc
      361 cccgccgagg tggtggacaa gtgcgaggcc atcgaggcac ccgaggatca ttgcgacgct
      421 gccgtcgcct ttgaaaactg catttacgag caaatgaagg agcatggact cgagctggag
      481 gaacactgaa caccgatttg attcccattg cgaacccgtt actgcatcac aagcgacccc
      541 tctggaatat aaccatctaa ttttttttat gtgtatccta tgactagtct ttaagtaacc
      601 gataaagtga gcaactgcaa gagataa