Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141426 439 bp mRNA linear INV 09-DEC-2024 (LOC108057251), mRNA. ACCESSION XM_017141426 VERSION XM_017141426.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141426.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..439 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..439 /gene="LOC108057251" /note="uncharacterized LOC108057251; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108057251" CDS 37..354 /gene="LOC108057251" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016996915.2" /db_xref="GeneID:108057251" /translation="MKPVLLFCLILTTALFLGQGHANPVEVDIPGPDANEIDSDLDSD EETPDKPLRIVSIKVRHIEADAALCAQQSPKHPHHPQCHSYCKRQGHWIGQCKKETCH CFS" ORIGIN 1 ctcctcagtt gtttgtttgc catcgagaag cgcacaatga agcctgtcct gctgttttgc 61 ctgatcctaa ccaccgctct gttcctgggc caaggtcacg cgaatcccgt cgaggtggac 121 attcccggcc ccgatgccaa cgaaatagac agcgatttgg acagcgatga ggagactccc 181 gacaagccac tgcgtatagt ttccatcaag gtccggcaca tcgaagcgga tgccgccctc 241 tgtgcccagc aatcgcccaa gcacccacac cacccacaat gccacagcta ctgcaagcgt 301 caaggtcact ggataggcca gtgcaagaag gaaacctgcc actgcttctc ctaggtattc 361 cacaccacat catctttttt ttttttaccc agaactcaaa aatattaact gtatgcgata 421 aactttaaga atgtgcaag