Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017141426             439 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108057251), mRNA.
ACCESSION   XM_017141426
VERSION     XM_017141426.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141426.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..439
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..439
                     /gene="LOC108057251"
                     /note="uncharacterized LOC108057251; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108057251"
     CDS             37..354
                     /gene="LOC108057251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016996915.2"
                     /db_xref="GeneID:108057251"
                     /translation="MKPVLLFCLILTTALFLGQGHANPVEVDIPGPDANEIDSDLDSD
                     EETPDKPLRIVSIKVRHIEADAALCAQQSPKHPHHPQCHSYCKRQGHWIGQCKKETCH
                     CFS"
ORIGIN      
        1 ctcctcagtt gtttgtttgc catcgagaag cgcacaatga agcctgtcct gctgttttgc
       61 ctgatcctaa ccaccgctct gttcctgggc caaggtcacg cgaatcccgt cgaggtggac
      121 attcccggcc ccgatgccaa cgaaatagac agcgatttgg acagcgatga ggagactccc
      181 gacaagccac tgcgtatagt ttccatcaag gtccggcaca tcgaagcgga tgccgccctc
      241 tgtgcccagc aatcgcccaa gcacccacac cacccacaat gccacagcta ctgcaagcgt
      301 caaggtcact ggataggcca gtgcaagaag gaaacctgcc actgcttctc ctaggtattc
      361 cacaccacat catctttttt ttttttaccc agaactcaaa aatattaact gtatgcgata
      421 aactttaaga atgtgcaag