Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141425 568 bp mRNA linear INV 09-DEC-2024 (Obp19a), mRNA. ACCESSION XM_017141425 VERSION XM_017141425.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141425.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..568 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..568 /gene="Obp19a" /note="Odorant-binding protein 19a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 29 Proteins" /db_xref="GeneID:108057250" CDS 1..441 /gene="Obp19a" /codon_start=1 /product="general odorant-binding protein 19a" /protein_id="XP_016996914.1" /db_xref="GeneID:108057250" /translation="MKFHLLLICVAISMGPLPASEAGVTEEQMWSAGKLMRDVCLPKY PKVSVEVADNIRNGNIPNSKDSNCYINCILEMMQAIKKGKFQLEPTLKQMDIMLPDSY KDEYRKGINLCKDSTVGLKNAPNCDPAHALLSCLKNNIKVFVFP" misc_feature 73..417 /gene="Obp19a" /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395" /db_xref="CDD:460193" misc_feature order(208..210,220..222,238..240,385..387,406..408) /gene="Obp19a" /note="ligand binding site [chemical binding]; other site" /db_xref="CDD:467938" ORIGIN 1 atgaagttcc atctgctgct gatctgtgtc gccatttcga tgggaccgct gcccgcatcg 61 gaggcagggg tgacggagga gcagatgtgg tcggccggca aactaatgcg cgacgtctgc 121 ctgcccaagt atcccaaggt cagcgtggag gtcgccgaca acattcgcaa cgggaatata 181 ccaaatagca aggacagcaa ctgctacatc aattgcatcc tggaaatgat gcaggcgatc 241 aagaagggca agttccagct ggagccgacc ctgaagcaga tggacatcat gctgccggac 301 agctacaagg acgagtaccg caagggcatc aacctgtgca aggactcgac cgtgggcctc 361 aagaacgccc ccaactgcga tcccgcccac gctttgctct cctgcctgaa gaacaacatc 421 aaggtgttcg tgtttccgta ggataccaga atactagaaa tgcatccgca actgatagag 481 atcagatcgc aatatccatt gaccaaagag cgcccctttc cctaattccc cgccctagaa 541 gccccagatc aataaaggtt agcccgag