Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Odorant-binding protein 19a


LOCUS       XM_017141425             568 bp    mRNA    linear   INV 09-DEC-2024
            (Obp19a), mRNA.
ACCESSION   XM_017141425
VERSION     XM_017141425.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141425.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..568
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..568
                     /gene="Obp19a"
                     /note="Odorant-binding protein 19a; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 29
                     Proteins"
                     /db_xref="GeneID:108057250"
     CDS             1..441
                     /gene="Obp19a"
                     /codon_start=1
                     /product="general odorant-binding protein 19a"
                     /protein_id="XP_016996914.1"
                     /db_xref="GeneID:108057250"
                     /translation="MKFHLLLICVAISMGPLPASEAGVTEEQMWSAGKLMRDVCLPKY
                     PKVSVEVADNIRNGNIPNSKDSNCYINCILEMMQAIKKGKFQLEPTLKQMDIMLPDSY
                     KDEYRKGINLCKDSTVGLKNAPNCDPAHALLSCLKNNIKVFVFP"
     misc_feature    73..417
                     /gene="Obp19a"
                     /note="PBP/GOBP family; Region: PBP_GOBP; pfam01395"
                     /db_xref="CDD:460193"
     misc_feature    order(208..210,220..222,238..240,385..387,406..408)
                     /gene="Obp19a"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:467938"
ORIGIN      
        1 atgaagttcc atctgctgct gatctgtgtc gccatttcga tgggaccgct gcccgcatcg
       61 gaggcagggg tgacggagga gcagatgtgg tcggccggca aactaatgcg cgacgtctgc
      121 ctgcccaagt atcccaaggt cagcgtggag gtcgccgaca acattcgcaa cgggaatata
      181 ccaaatagca aggacagcaa ctgctacatc aattgcatcc tggaaatgat gcaggcgatc
      241 aagaagggca agttccagct ggagccgacc ctgaagcaga tggacatcat gctgccggac
      301 agctacaagg acgagtaccg caagggcatc aacctgtgca aggactcgac cgtgggcctc
      361 aagaacgccc ccaactgcga tcccgcccac gctttgctct cctgcctgaa gaacaacatc
      421 aaggtgttcg tgtttccgta ggataccaga atactagaaa tgcatccgca actgatagag
      481 atcagatcgc aatatccatt gaccaaagag cgcccctttc cctaattccc cgccctagaa
      541 gccccagatc aataaaggtt agcccgag