Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141423 643 bp mRNA linear INV 09-DEC-2024 (LOC108057249), mRNA. ACCESSION XM_017141423 VERSION XM_017141423.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141423.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..643 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..643 /gene="LOC108057249" /note="uncharacterized LOC108057249; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108057249" CDS 92..346 /gene="LOC108057249" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016996912.2" /db_xref="GeneID:108057249" /translation="MLSSDRTMARLVMDSIDAMGGSASKEVILRTLSTATRTRVIKLV DKVDEIMDYFVERGLIRKQNGEYHIVKIIDTPKEIFDFYN" polyA_site 643 /gene="LOC108057249" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attttatacc ccacttcggt tgtgtttgga cgtctcaatt taaaatattt ttctcccaaa 61 attgtacgta gtttttttta taactggaaa tatgttgtca agtgatagaa cgatggcgcg 121 acttgtgatg gattccattg atgccatggg tggttccgcc tccaaagaag tgatcctgcg 181 tactttgagc acggccacca gaaccagagt cataaaacta gtggataaag tggatgaaat 241 catggactat tttgtggaga gaggactaat ccgaaagcag aatggagagt atcatatcgt 301 taaaataatt gatacaccaa aggaaatatt cgatttttac aattaaagat gataccaatg 361 ccaaggtcaa gaacttgttc attgtaaatt tgttgtgcaa attcctgttg gccaaaatcg 421 aaactgattt actaattttc ttaaatggta aaaaatgcaa aatttgaata cctaagtata 481 gacttttaga atattacaaa gagaccttct ggaagtatca ccaacatata agttaattta 541 catgaaattt gtgtgcatct gagctcgtga aatacacaaa ttattgtttc gcacgcagct 601 gcgcagtttt agtgactaac aataaacaag ttgagttagc aga