Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017141423             643 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108057249), mRNA.
ACCESSION   XM_017141423
VERSION     XM_017141423.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141423.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..643
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..643
                     /gene="LOC108057249"
                     /note="uncharacterized LOC108057249; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108057249"
     CDS             92..346
                     /gene="LOC108057249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016996912.2"
                     /db_xref="GeneID:108057249"
                     /translation="MLSSDRTMARLVMDSIDAMGGSASKEVILRTLSTATRTRVIKLV
                     DKVDEIMDYFVERGLIRKQNGEYHIVKIIDTPKEIFDFYN"
     polyA_site      643
                     /gene="LOC108057249"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attttatacc ccacttcggt tgtgtttgga cgtctcaatt taaaatattt ttctcccaaa
       61 attgtacgta gtttttttta taactggaaa tatgttgtca agtgatagaa cgatggcgcg
      121 acttgtgatg gattccattg atgccatggg tggttccgcc tccaaagaag tgatcctgcg
      181 tactttgagc acggccacca gaaccagagt cataaaacta gtggataaag tggatgaaat
      241 catggactat tttgtggaga gaggactaat ccgaaagcag aatggagagt atcatatcgt
      301 taaaataatt gatacaccaa aggaaatatt cgatttttac aattaaagat gataccaatg
      361 ccaaggtcaa gaacttgttc attgtaaatt tgttgtgcaa attcctgttg gccaaaatcg
      421 aaactgattt actaattttc ttaaatggta aaaaatgcaa aatttgaata cctaagtata
      481 gacttttaga atattacaaa gagaccttct ggaagtatca ccaacatata agttaattta
      541 catgaaattt gtgtgcatct gagctcgtga aatacacaaa ttattgtttc gcacgcagct
      601 gcgcagtttt agtgactaac aataaacaag ttgagttagc aga