Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii heterogeneous nuclear


LOCUS       XM_017141422             658 bp    mRNA    linear   INV 09-DEC-2024
            ribonucleoprotein A3 (LOC108057248), mRNA.
ACCESSION   XM_017141422
VERSION     XM_017141422.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141422.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..658
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..658
                     /gene="LOC108057248"
                     /note="heterogeneous nuclear ribonucleoprotein A3; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108057248"
     CDS             50..532
                     /gene="LOC108057248"
                     /codon_start=1
                     /product="heterogeneous nuclear ribonucleoprotein A3"
                     /protein_id="XP_016996911.2"
                     /db_xref="GeneID:108057248"
                     /translation="MSNFNRILSGSIVICLALVKFSAVDAQAGTVHWNNGNAAGVGAY
                     SNAQSGGMHPPGSLSGQDPQYSYGYAGIDSRGSYGGAGGNGGYYVSGTDEHGRPFSYG
                     NQAGQPGQLGQPGYVGGRPDPNYPGSYGYQSGAAVISSPVGATLTLAALGFTLATMRL
                     "
     polyA_site      658
                     /gene="LOC108057248"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cggcactttg ttagcggttt agttggagtt aagcgcgcat tcggtaaaca tgtcgaattt
       61 caatcggatc ttgagcggca gcattgtgat ctgcctggca cttgtcaagt ttagtgcggt
      121 ggacgctcag gccggaacgg tgcactggaa taacgggaat gcggctggcg tgggcgccta
      181 ttcgaacgcc cagtcgggtg gaatgcatcc gccgggcagt ctgagtggcc aggatccgca
      241 gtacagctac ggctatgccg gcatcgattc gcggggctcc tacggcggag cgggcggcaa
      301 tggtggctac tacgtgagcg gcacagacga gcatggtcgc cccttctcct acggcaacca
      361 ggccggtcag ccaggacagc tgggacagcc gggctacgtg ggcggacggc cggatcccaa
      421 ctatccgggc tcctacggct atcagagcgg ggcagcggtc attagcagcc cagtgggcgc
      481 gaccttgacc ctggcggcac tgggatttac gctggccacc atgagactgt aatgcggtgt
      541 ttattgtgtt gatcggttct ttttttttta catagtttct aagcctaatt tatgttactt
      601 tttttattat gtaaattttt cattaaatac aaaaactgaa gatcaagaca atgcttta