Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii amnesiac (amn), mRNA.


LOCUS       XM_017141417             678 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017141417
VERSION     XM_017141417.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; corrected model.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141417.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts          :: corrected 2 indels
            internal stop codons :: corrected 1 genomic stop codons
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-303               JARPSC010000001.1  19848919-19849221
            304-411             JARPSC010000001.1  19849224-19849331
            412-678             JARPSC010000001.1  19849334-19849600
FEATURES             Location/Qualifiers
     source          1..678
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..678
                     /gene="amn"
                     /note="amnesiac; The sequence of the model RefSeq
                     transcript was modified relative to its source genomic
                     sequence to represent the inferred CDS: deleted 4 bases in
                     2 codons; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:108057243"
     CDS             1..660
                     /gene="amn"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 4 bases in 2 codons;
                     substituted 1 base at 1 genomic stop codon"
                     /codon_start=1
                     /transl_except=(pos:115..117,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: amnesiac neuropeptides"
                     /protein_id="XP_016996906.3"
                     /db_xref="GeneID:108057243"
                     /translation="MRSSCFCCCSYSAAVALQCVLLFLCSVFLFAFGASASRXRVVSD
                     LKGGGALALCRRLEQLREPNGAEERRTGPDAPALPPLPLYDYVCVRCKRSYIPRPNFY
                     SDFSLVFLLGQFSLAVRFGPTLVASWPLCNDSETKAHERLTKWPSCSLIGRPTAPRGD
                     PKCGLSPARSLTLSPLAWGSKRRKSQNTRTIQKPSFPTNTYPLICFVFSNFIKLLYFL
                     I"
ORIGIN      
        1 atgcgcagtt cttgtttttg ttgttgttcc tattcggctg ctgtggcgct gcagtgcgta
       61 ttactttttc tctgttccgt ttttcttttt gcgtttggag cgtccgcgtc gcgctgacgc
      121 gttgtaagcg atttgaaagg tggcggagca ctggcgctct gccgccgatt ggaacagctg
      181 agagagccga atggtgccga ggagcgccga accggacccg atgcgcccgc actaccacca
      241 ctaccactat atgactacgt gtgtgtgcgt tgtaaacgct cttacattcc gcggccgaat
      301 ttttattcgg acttttccct tgtttttctt ttgggccagt tcagtttggc tgtgcggttt
      361 gggccaacac ttgtcgcctc ttggccatta tgcaacgaca gcgaaacgaa ggctcacgaa
      421 cggctcacga agtggccaag ctgctctctg attggtcggc cgacggcgcc acgaggcgac
      481 ccgaagtgcg gcctctctcc cgctcggtct ctcactctct ctcctctcgc atgggggagc
      541 aagaggagga aaagccaaaa cactcgaaca atccagaagc cgagttttcc gactaacaca
      601 tacccgttaa tctgttttgt tttttctaat tttatcaaat tattatactt cttaatttaa
      661 gagtaatata atactttg