PREDICTED: Drosophila takahashii putative odorant receptor 19b

LOCUS       XM_017141414            1170 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108057240), mRNA.
ACCESSION   XM_017141414
VERSION     XM_017141414.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017141414.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1170
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1170
                     /gene="LOC108057240"
                     /note="putative odorant receptor 19b; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:108057240"
     CDS             1..1170
                     /gene="LOC108057240"
                     /codon_start=1
                     /product="putative odorant receptor 19b"
                     /protein_id="XP_016996903.2"
                     /db_xref="GeneID:108057240"
                     /translation="MSIVEVDSTRALVSHWRIFRMIGLHPPDKATMWGRHYRAYSIAW
                     NLAFHVCMWVSFVVNFLLSNSLETFCESLCVAMPHTLYMLKVINVYLKRDEMLHIHQL
                     LRYLDGRLGCPEEFRIIGEGVAAAEFIFRVILRAVVGVVVLGVFYISLASEPTLMYPS
                     WIPWNWKDTTAAYLPTIILHTFALIETAMVVLNLSTYPCTYFILISAHTKALALRVSR
                     LGHGQSLPAHRMQAILLGYIQDHQIILHLFRSLERSLSMTCFMQFFCTACAQCTISYF
                     LLFEEVGIMRFTNMMSLLMAFTTESLLLCYTAELLCREGESLLAAVYSCNWLDQSVHF
                     RRLLLLMLVRCQKPLILVSGIIVPISMKTFMVMVKGAYTMLTLLNEMRKASLEYN"
     misc_feature    193..1116
                     /gene="LOC108057240"
                     /note="7tm Odorant receptor; Region: 7tm_6; pfam02949"
                     /db_xref="CDD:251636"
ORIGIN      
        1 atgtccattg tggaagtgga ttcaacgagg gctttggtaa gccattggcg catctttcgg
       61 atgattggat tgcatccgcc ggataaggcg accatgtggg gtcgccacta cagggcgtac
      121 tcgatagcct ggaatttggc ctttcacgtc tgcatgtggg tgtccttcgt ggtgaacttc
      181 ctgctgtcca actcgctgga gaccttctgc gagagccttt gcgtggccat gccgcacacg
      241 ctctacatgc tgaaggtgat caatgtctat ttgaagcgcg acgagatgct ccacatccac
      301 cagttgctcc ggtatctgga cggccgactg ggctgccccg aggagttccg gattatcggc
      361 gagggagtcg ccgcagcgga gttcatattc cgcgtcattt tgcgcgccgt tgtcggtgtg
      421 gtcgttctcg gcgtttttta catctccctg gccagcgaac ccacgctgat gtatccctcc
      481 tggatcccgt ggaactggaa ggacaccacc gccgcctacc tgcccaccat catcctgcac
      541 accttcgccc tgatagaaac ggccatggtg gtgctcaatt taagcaccta tccgtgcacc
      601 tacttcatcc tgatcagcgc ccacaccaag gcgctcgccc tgcgagtctc cagattggga
      661 cacggtcaat ccctcccagc gcaccgcatg caggccatcc tgttgggcta tatacaggac
      721 catcagatca ttttgcatct gttcagatcg ctggagagat ccctttcgat gacctgcttc
      781 atgcagttct tctgcacagc ctgtgcccag tgcaccatct cctacttcct gctcttcgag
      841 gaagtgggga tcatgaggtt caccaacatg atgtctcttc tgatggcctt caccacggaa
      901 tccctgctgc tctgctacac ggcggagctc ctctgccggg agggcgagag tctgctggcg
      961 gcggtctaca gctgcaattg gctggaccag tcggtccact tccggcgact cctcctcctg
     1021 atgctcgtgc gctgccagaa gccgctgatc ctggtctccg ggataatagt gcccatcagc
     1081 atgaagacct ttatggtgat ggtcaaggga gcctacacca tgcttacttt gctaaatgaa
     1141 atgcgcaaag cgtcactgga atacaactaa