Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii calcineurin B homologous protein


LOCUS       XM_017141409             516 bp    mRNA    linear   INV 09-DEC-2024
            1-like (LOC108057235), mRNA.
ACCESSION   XM_017141409
VERSION     XM_017141409.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017141409.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..516
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..516
                     /gene="LOC108057235"
                     /note="calcineurin B homologous protein 1-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 45 Proteins"
                     /db_xref="GeneID:108057235"
     CDS             1..516
                     /gene="LOC108057235"
                     /codon_start=1
                     /product="calcineurin B homologous protein 1-like"
                     /protein_id="XP_016996898.2"
                     /db_xref="GeneID:108057235"
                     /translation="MGTAASRHLTAEELLEIQAETGFSLARLDYLYGHYQSLDRDSED
                     RVLRSELLRVPPVAAHPLAERLVDAMLHPSLGFRHFVGGLANFRRSEPLDRKLASTLR
                     LFDEDGDGLLSADQCHALLARLPATRRELRAMRWRLKQILEEKDKLDSEDFGHITRGL
                     DLEQSLSLRFH"
ORIGIN      
        1 atgggcacgg ctgcctcccg ccatttgacc gccgaggagc tgctcgaaat ccaggcggag
       61 acgggattct cgctggcgcg actcgactat ctgtatggcc actatcagtc gctcgatcgc
      121 gactccgagg atcgcgtcct gcggagcgaa ctgctgcgag tgccgccggt ggccgcccat
      181 ccgctggccg agcgcctggt ggacgccatg ctgcatccgt cgctcggctt ccggcacttc
      241 gtcggcggac tggccaactt ccggcgcagc gagccgctcg accggaagtt ggcctccact
      301 ctgcgtctgt tcgacgagga cggcgatggg ctgctgagcg ccgaccagtg ccacgccctc
      361 ttggcccgcc taccggcgac gcggcgggag ctgcgtgcga tgcgctggcg actcaagcag
      421 attctcgagg agaaggataa gctggactcg gaggactttg gccacatcac caggggtctg
      481 gacctcgagc agagtctctc gctgcgattc cactga