Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141409 516 bp mRNA linear INV 09-DEC-2024 1-like (LOC108057235), mRNA. ACCESSION XM_017141409 VERSION XM_017141409.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017141409.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..516 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..516 /gene="LOC108057235" /note="calcineurin B homologous protein 1-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 45 Proteins" /db_xref="GeneID:108057235" CDS 1..516 /gene="LOC108057235" /codon_start=1 /product="calcineurin B homologous protein 1-like" /protein_id="XP_016996898.2" /db_xref="GeneID:108057235" /translation="MGTAASRHLTAEELLEIQAETGFSLARLDYLYGHYQSLDRDSED RVLRSELLRVPPVAAHPLAERLVDAMLHPSLGFRHFVGGLANFRRSEPLDRKLASTLR LFDEDGDGLLSADQCHALLARLPATRRELRAMRWRLKQILEEKDKLDSEDFGHITRGL DLEQSLSLRFH" ORIGIN 1 atgggcacgg ctgcctcccg ccatttgacc gccgaggagc tgctcgaaat ccaggcggag 61 acgggattct cgctggcgcg actcgactat ctgtatggcc actatcagtc gctcgatcgc 121 gactccgagg atcgcgtcct gcggagcgaa ctgctgcgag tgccgccggt ggccgcccat 181 ccgctggccg agcgcctggt ggacgccatg ctgcatccgt cgctcggctt ccggcacttc 241 gtcggcggac tggccaactt ccggcgcagc gagccgctcg accggaagtt ggcctccact 301 ctgcgtctgt tcgacgagga cggcgatggg ctgctgagcg ccgaccagtg ccacgccctc 361 ttggcccgcc taccggcgac gcggcgggag ctgcgtgcga tgcgctggcg actcaagcag 421 attctcgagg agaaggataa gctggactcg gaggactttg gccacatcac caggggtctg 481 gacctcgagc agagtctctc gctgcgattc cactga