Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017141095 960 bp mRNA linear INV 09-DEC-2024 (LOC108057025), mRNA. ACCESSION XM_017141095 VERSION XM_017141095.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017141095.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..960 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..960 /gene="LOC108057025" /note="uncharacterized LOC108057025; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108057025" CDS 70..930 /gene="LOC108057025" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016996584.2" /db_xref="GeneID:108057025" /translation="MENQVILLNSWHTSNSTITLSDFHRLGIPDGHKYIPKAFEIEPP YQKDFRLPWTTLSVVTDTFLYAKYHNLTLTDDGSDQDAQNVGQANSQLYVSDNTNAEL QPMEPEALMEFSGGETEYNLPKPSISIRASGDKGIPGEGSNHLKPQSSMENTGGENGI PKYSTDIPNEELDLLVPQNVIEVSNDEEHIGNYFLNIRDEENIEEYFSDIRDGKNIRN YFSDFRGDEDYSLEFQTSTEGTGDEKNICNLDEEYNLRERGTLTAVLGDNNTTDEEYI LNYILSIRDE" ORIGIN 1 tgtcaaaata gaacgtttgt tgtcagtgac agttcaatag aaattctttg agaagtacac 61 aatagtagga tggagaacca agtaatattg ctaaacagct ggcatacatc aaattcgact 121 ataactctaa gcgatttcca ccggctgggc attcccgatg gacacaagta cattccaaag 181 gcgttcgaga tcgagccgcc gtaccaaaag gactttcgcc tgccttggac gacactgtcc 241 gtagttaccg atacttttct ctatgccaag taccataacc taacgcttac ggatgatggg 301 tcggatcagg acgcccagaa cgttggtcag gccaatagtc agctttatgt ctcagacaac 361 actaacgcgg aacttcagcc aatggaacct gaagccttaa tggaattttc tggtggtgaa 421 actgaataca atctaccaaa gccatcaatt tcaattcgcg cttctggtga taagggtatt 481 cctggcgaag gaagtaatca cttgaaaccg caatcttcaa tggaaaacac tggaggtgaa 541 aatggtatcc cgaaatactc gacagacatt cccaacgagg aattggatct actggtgcct 601 caaaatgtaa tagaagtttc taacgatgag gaacatatcg ggaactattt tttgaacatc 661 cgtgatgagg aaaacatcga ggaatatttt tctgatatcc gtgatggaaa aaatatcagg 721 aattattttt ctgacttccg tggtgacgaa gactattctc tggaatttca aacttcaacc 781 gaaggcactg gcgatgagaa gaacatttgc aatcttgacg aagaatacaa tctgcgcgag 841 cgtggaactt tgacggctgt ccttggagat aacaatacga ctgatgagga gtatatcctg 901 aactatattt taagtatccg tgacgaataa ataaatgctc ttaaattcag aagaggtaag