Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017141095             960 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108057025), mRNA.
ACCESSION   XM_017141095
VERSION     XM_017141095.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017141095.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..960
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..960
                     /gene="LOC108057025"
                     /note="uncharacterized LOC108057025; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108057025"
     CDS             70..930
                     /gene="LOC108057025"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016996584.2"
                     /db_xref="GeneID:108057025"
                     /translation="MENQVILLNSWHTSNSTITLSDFHRLGIPDGHKYIPKAFEIEPP
                     YQKDFRLPWTTLSVVTDTFLYAKYHNLTLTDDGSDQDAQNVGQANSQLYVSDNTNAEL
                     QPMEPEALMEFSGGETEYNLPKPSISIRASGDKGIPGEGSNHLKPQSSMENTGGENGI
                     PKYSTDIPNEELDLLVPQNVIEVSNDEEHIGNYFLNIRDEENIEEYFSDIRDGKNIRN
                     YFSDFRGDEDYSLEFQTSTEGTGDEKNICNLDEEYNLRERGTLTAVLGDNNTTDEEYI
                     LNYILSIRDE"
ORIGIN      
        1 tgtcaaaata gaacgtttgt tgtcagtgac agttcaatag aaattctttg agaagtacac
       61 aatagtagga tggagaacca agtaatattg ctaaacagct ggcatacatc aaattcgact
      121 ataactctaa gcgatttcca ccggctgggc attcccgatg gacacaagta cattccaaag
      181 gcgttcgaga tcgagccgcc gtaccaaaag gactttcgcc tgccttggac gacactgtcc
      241 gtagttaccg atacttttct ctatgccaag taccataacc taacgcttac ggatgatggg
      301 tcggatcagg acgcccagaa cgttggtcag gccaatagtc agctttatgt ctcagacaac
      361 actaacgcgg aacttcagcc aatggaacct gaagccttaa tggaattttc tggtggtgaa
      421 actgaataca atctaccaaa gccatcaatt tcaattcgcg cttctggtga taagggtatt
      481 cctggcgaag gaagtaatca cttgaaaccg caatcttcaa tggaaaacac tggaggtgaa
      541 aatggtatcc cgaaatactc gacagacatt cccaacgagg aattggatct actggtgcct
      601 caaaatgtaa tagaagtttc taacgatgag gaacatatcg ggaactattt tttgaacatc
      661 cgtgatgagg aaaacatcga ggaatatttt tctgatatcc gtgatggaaa aaatatcagg
      721 aattattttt ctgacttccg tggtgacgaa gactattctc tggaatttca aacttcaacc
      781 gaaggcactg gcgatgagaa gaacatttgc aatcttgacg aagaatacaa tctgcgcgag
      841 cgtggaactt tgacggctgt ccttggagat aacaatacga ctgatgagga gtatatcctg
      901 aactatattt taagtatccg tgacgaataa ataaatgctc ttaaattcag aagaggtaag