Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii NADH:ubiquinone oxidoreductase


LOCUS       XM_017140787             476 bp    mRNA    linear   INV 09-DEC-2024
            subunit A3 (NdufA3), mRNA.
ACCESSION   XM_017140787
VERSION     XM_017140787.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140787.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..476
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..476
                     /gene="NdufA3"
                     /note="NADH:ubiquinone oxidoreductase subunit A3; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108056800"
     CDS             170..403
                     /gene="NdufA3"
                     /codon_start=1
                     /product="uncharacterized protein NdufA3"
                     /protein_id="XP_016996276.1"
                     /db_xref="GeneID:108056800"
                     /translation="MSASAARGSTSLLKRAWNEIPDIVGGSALALAGIVMATIGVANY
                     YANDGDNRKYKLGYVVFRHDDPRAQKVRTEEDD"
     polyA_site      476
                     /gene="NdufA3"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 catctatttt ggaatataaa tcccccaaaa agcccattta cgatactcag gtaatcgaaa
       61 ttcggccacc cccagctaca gcaacaatcg attggcgata gacgatagtt gccagctgtt
      121 tggtcgcccg tttgtgttgt gtaactgagt ttcatttttg aacaccaaga tgtccgcatc
      181 cgctgcccga ggctccacgt cgctgctgaa gcgcgcctgg aacgagattc cggacatcgt
      241 cggcggatcc gccttggccc tcgccgggat cgtgatggcc accatcgggg tggccaacta
      301 ctacgccaac gacggggaca accggaagta caagctcggc tacgtcgtct tccgccacga
      361 cgatccgcgc gcccagaaag tccgcaccga ggaggatgac taggggacta ctatggactc
      421 tcatctttga tttatttgtt tacgccatag ctaagtaaaa caaacgataa aatgta