Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140786 1069 bp mRNA linear INV 09-DEC-2024 (Dlip1), transcript variant X2, mRNA. ACCESSION XM_017140786 VERSION XM_017140786.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140786.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1069 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1069 /gene="Dlip1" /note="Dorsal interacting protein 1; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108056799" CDS 154..702 /gene="Dlip1" /codon_start=1 /product="uncharacterized protein Dlip1 isoform X2" /protein_id="XP_016996275.2" /db_xref="GeneID:108056799" /translation="MDIFESFCRTCGNECPESVGIYEESVRALDKMVPLAEMLAACLP ASLPPMDPGDDYPKQICRICVKKLSLAYEFSHQWLGAHAEFNVALKFEQRRKRSLARI TQSQAQSQSQLQQSQPQDEEQLPTEAPATDVEPLKAAPASVATTTSSSETRLGFRCGI CNESFHTEKACKFHFKFSHKDL" misc_feature 175..417 /gene="Dlip1" /note="Zinc-finger associated domain (zf-AD); Region: zf-AD; pfam07776" /db_xref="CDD:462262" ORIGIN 1 agggtatggc aaagtacaga aaaataccac aaaaatacca aagaaatacc aagatctatc 61 gctaatcgat ttccgttgcc ccacaaatta taaacaaacc aattttgaat ttttaaaagg 121 aatcgttaaa aaggacaccc catcgcaatc cagatggaca tcttcgagag cttctgccgg 181 acgtgcggca acgagtgccc ggagtcggtg ggcatctacg aggagagcgt gcgggcgctg 241 gacaagatgg tgcccctggc ggagatgctg gccgcctgtc tgcccgcctc cctgccgccg 301 atggacccag gcgacgacta tcccaagcag atctgccgga tctgcgtgaa gaagctgtcg 361 ctggcctacg agttcagcca ccagtggctg ggcgcccacg ccgagttcaa cgtggcgttg 421 aagttcgagc agcgcaggaa gcgcagcctg gcgaggatta cccagtcgca ggcgcagtcg 481 cagtcccagt tgcagcaatc ccagccgcag gacgaggagc agctgcccac cgaggcaccg 541 gcaacggatg tggagcccct gaaagctgct cctgcgagcg tcgccaccac cacgagcagc 601 agcgaaacca ggctgggctt caggtgcggc atctgcaacg agagcttcca cacggagaag 661 gcctgcaagt tccacttcaa gttctcgcac aaggatcttt agtccgtctc gcccactagc 721 tctcagtttt gtataaatgt ttaagtacgt tatttgtaat agtttgtaat gatacgccct 781 agcatgagat gtaaatcacg atatcatatg cagaacttat atattaatta ttagtattgt 841 aaccgcgttt ctctttgtac aataagatat cggctgaaat caatcattag atcgaattcc 901 tccaagaata accatatttc tctttgtaca ttgcgatatt atatacagaa tttaaaggaa 961 acctatcatt agatcgagtt cctttaagaa caaccatatt tctccttgta cattgcgata 1021 ttaaaaacag aattaaaagg aaacccatca ttagatcgag ttactttaa