Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii protein SMG9 (LOC108056793), mRNA.


LOCUS       XM_017140780            1960 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017140780
VERSION     XM_017140780.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140780.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1960
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1960
                     /gene="LOC108056793"
                     /note="protein SMG9; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108056793"
     CDS             95..1558
                     /gene="LOC108056793"
                     /codon_start=1
                     /product="protein SMG9"
                     /protein_id="XP_016996269.2"
                     /db_xref="GeneID:108056793"
                     /translation="MAEPRRRFRNKKRDDSSAGLLAPVTIARREDARMVQPKILLKKD
                     RDRDREWDRDRERERDRDREAERDKEKDKETEATPGCYPDAPAAIKTIIINRTSEVRC
                     PMGITGIGGAGGAGGVSSGGAPLPATLPSGSVCAALVSSASNGREKGTTTAPPNPLQE
                     LQPPRMNRPTPLIVANGIFNANARKLFHKTNTDFTVIGVLGGQCSGKSTLLNLLATER
                     PLDYDYYQHLLSPEADECIFATRHKAKPNNNNNSKMRPRTETLQFFITRERHILLDTP
                     PLLPVGKEPDHQDLHSLAAMAQLLSVCHVLILAIDGLAVEQLRLLNAALRLRPTFPCK
                     GYVRDHLPQVLFVRNRAQRLDFEPQQRERLDRKLAYLYGATGLPIYRGKGEARSLNTF
                     LLPEVSGNGATAFHPGLGELVRQFRERVLGATRISMCHTSTELSEAIWFEILAESARK
                     GAPHFEKIYAEIKLRHLDTRCQWRADNWRTFSAGAES"
     misc_feature    656..>739
                     /gene="LOC108056793"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    695..718
                     /gene="LOC108056793"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     polyA_site      1960
                     /gene="LOC108056793"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtttatgta tcgcccagtg tgttcaaatc acaaacgtgt tcaaatccaa ggaaaggggt
       61 tccaggttcc aagatacaaa taaccggcca ccgaatggcc gaaccccgtc gccgtttccg
      121 caacaagaag cgcgatgact cctccgccgg cctcctggcg ccggtgacca ttgcccgtcg
      181 cgaggacgcc cgcatggtgc agccgaagat tctgctgaag aaggatcgcg accgggacag
      241 ggagtgggac agggacaggg agagggagag ggacagagat cgggaggcgg agcgggacaa
      301 ggagaaggac aaggagacgg aggcgactcc cggctgctat cccgatgccc cggcggccat
      361 caagacgatc atcatcaatc ggacgagcga ggtgcgatgt ccgatgggca taacaggaat
      421 aggaggagca ggaggagcag gaggcgtatc atccggaggc gctcccctcc cagccaccct
      481 gccctccggc tccgtttgcg cggcattggt tagctcggct tcgaatggcc gggaaaaagg
      541 aaccaccacc gctccaccca atcccctcca ggagctgcag ccgccgcgga tgaaccgccc
      601 cacgccgctg atcgtggcca acgggatctt caatgccaat gcccgcaagc tgttccacaa
      661 aaccaacacg gacttcaccg tcatcggcgt tctgggtggc cagtgctcgg ggaagagcac
      721 gctgctcaat cttttggcca cggagcggcc cctggactac gactactacc agcatctgct
      781 ctctcccgag gcggatgagt gcatctttgc cacgcggcac aaggcgaagc cgaacaataa
      841 taataatagt aaaatgcgtc cgcgcaccga aacgctgcag ttcttcatca cgcgcgagcg
      901 tcacatcctc ctggacacgc cgcctctgct gccggtgggc aaggagccgg atcaccagga
      961 cctgcactcc ctcgccgcca tggcgcagct gctgagcgtg tgccatgtgc tcatcctggc
     1021 catcgacggc ctggccgtgg agcagctgcg tctgttgaac gccgctttgc gcctgcgtcc
     1081 gacttttccc tgcaagggct atgtgcgtga tcatctgccg caggtgctgt tcgtgcgcaa
     1141 tcgcgcccag cggctggact ttgagccgca gcagcgcgag cggctggaca ggaagctggc
     1201 gtatctgtac ggagccaccg gactgcccat ttaccggggc aaaggcgagg cgcgctcact
     1261 aaacaccttc ctgctgcccg aggtgagcgg caacggagcc accgccttcc atcccggcct
     1321 gggcgagcta gtgcgtcaat ttcgcgagcg cgtgctgggc gccactcgca tctccatgtg
     1381 ccacaccagc accgaactga gcgaggccat ctggttcgag atcctcgccg agagcgcccg
     1441 caagggagcg ccgcacttcg agaagatcta tgcggagatc aagctgcgcc acctggacac
     1501 gcgatgccag tggcgggcgg acaactggcg caccttctcc gcaggcgcag agagctgatc
     1561 caaggatgat ctgcgattcg gaggacttct agtgattaaa gttccaatat caatgcgctg
     1621 gcctctcgtt ttactaaaca tttgtacaga aacagacagc ggcgttgggg gtcgaaacga
     1681 gtccattttc gaacgagttg ttcaaagtta acacttgtat gactgatata cacattgttt
     1741 tgcagatata tcatacatat ccatcattaa ataaaagact ctccaaaggg aataagtttt
     1801 ccgttgaaat tcaacgttta gcattcaaca ttggtgcttt gttctttgtt tctatcaaat
     1861 cgaatcgatc aataatacag cttttgagtt ggcaaattgg taaatttgta aactaaggcc
     1921 actgtaaatg aacaaataaa cattagttat ttatacttaa