Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140780 1960 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017140780 VERSION XM_017140780.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140780.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1960 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1960 /gene="LOC108056793" /note="protein SMG9; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056793" CDS 95..1558 /gene="LOC108056793" /codon_start=1 /product="protein SMG9" /protein_id="XP_016996269.2" /db_xref="GeneID:108056793" /translation="MAEPRRRFRNKKRDDSSAGLLAPVTIARREDARMVQPKILLKKD RDRDREWDRDRERERDRDREAERDKEKDKETEATPGCYPDAPAAIKTIIINRTSEVRC PMGITGIGGAGGAGGVSSGGAPLPATLPSGSVCAALVSSASNGREKGTTTAPPNPLQE LQPPRMNRPTPLIVANGIFNANARKLFHKTNTDFTVIGVLGGQCSGKSTLLNLLATER PLDYDYYQHLLSPEADECIFATRHKAKPNNNNNSKMRPRTETLQFFITRERHILLDTP PLLPVGKEPDHQDLHSLAAMAQLLSVCHVLILAIDGLAVEQLRLLNAALRLRPTFPCK GYVRDHLPQVLFVRNRAQRLDFEPQQRERLDRKLAYLYGATGLPIYRGKGEARSLNTF LLPEVSGNGATAFHPGLGELVRQFRERVLGATRISMCHTSTELSEAIWFEILAESARK GAPHFEKIYAEIKLRHLDTRCQWRADNWRTFSAGAES" misc_feature 656..>739 /gene="LOC108056793" /note="Members of the P-loop NTPase domain superfamily are characterized by a conserved nucleotide phosphate-binding motif, also referred to as the Walker A motif (GxxxxGK[S/T], where x is any residue), and the Walker B motif (hhhh[D/E], where h is a...; Region: P-loop containing Nucleoside Triphosphate Hydrolases; cl38936" /db_xref="CDD:476819" misc_feature 695..718 /gene="LOC108056793" /note="G1 box; other site" /db_xref="CDD:206648" polyA_site 1960 /gene="LOC108056793" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgtttatgta tcgcccagtg tgttcaaatc acaaacgtgt tcaaatccaa ggaaaggggt 61 tccaggttcc aagatacaaa taaccggcca ccgaatggcc gaaccccgtc gccgtttccg 121 caacaagaag cgcgatgact cctccgccgg cctcctggcg ccggtgacca ttgcccgtcg 181 cgaggacgcc cgcatggtgc agccgaagat tctgctgaag aaggatcgcg accgggacag 241 ggagtgggac agggacaggg agagggagag ggacagagat cgggaggcgg agcgggacaa 301 ggagaaggac aaggagacgg aggcgactcc cggctgctat cccgatgccc cggcggccat 361 caagacgatc atcatcaatc ggacgagcga ggtgcgatgt ccgatgggca taacaggaat 421 aggaggagca ggaggagcag gaggcgtatc atccggaggc gctcccctcc cagccaccct 481 gccctccggc tccgtttgcg cggcattggt tagctcggct tcgaatggcc gggaaaaagg 541 aaccaccacc gctccaccca atcccctcca ggagctgcag ccgccgcgga tgaaccgccc 601 cacgccgctg atcgtggcca acgggatctt caatgccaat gcccgcaagc tgttccacaa 661 aaccaacacg gacttcaccg tcatcggcgt tctgggtggc cagtgctcgg ggaagagcac 721 gctgctcaat cttttggcca cggagcggcc cctggactac gactactacc agcatctgct 781 ctctcccgag gcggatgagt gcatctttgc cacgcggcac aaggcgaagc cgaacaataa 841 taataatagt aaaatgcgtc cgcgcaccga aacgctgcag ttcttcatca cgcgcgagcg 901 tcacatcctc ctggacacgc cgcctctgct gccggtgggc aaggagccgg atcaccagga 961 cctgcactcc ctcgccgcca tggcgcagct gctgagcgtg tgccatgtgc tcatcctggc 1021 catcgacggc ctggccgtgg agcagctgcg tctgttgaac gccgctttgc gcctgcgtcc 1081 gacttttccc tgcaagggct atgtgcgtga tcatctgccg caggtgctgt tcgtgcgcaa 1141 tcgcgcccag cggctggact ttgagccgca gcagcgcgag cggctggaca ggaagctggc 1201 gtatctgtac ggagccaccg gactgcccat ttaccggggc aaaggcgagg cgcgctcact 1261 aaacaccttc ctgctgcccg aggtgagcgg caacggagcc accgccttcc atcccggcct 1321 gggcgagcta gtgcgtcaat ttcgcgagcg cgtgctgggc gccactcgca tctccatgtg 1381 ccacaccagc accgaactga gcgaggccat ctggttcgag atcctcgccg agagcgcccg 1441 caagggagcg ccgcacttcg agaagatcta tgcggagatc aagctgcgcc acctggacac 1501 gcgatgccag tggcgggcgg acaactggcg caccttctcc gcaggcgcag agagctgatc 1561 caaggatgat ctgcgattcg gaggacttct agtgattaaa gttccaatat caatgcgctg 1621 gcctctcgtt ttactaaaca tttgtacaga aacagacagc ggcgttgggg gtcgaaacga 1681 gtccattttc gaacgagttg ttcaaagtta acacttgtat gactgatata cacattgttt 1741 tgcagatata tcatacatat ccatcattaa ataaaagact ctccaaaggg aataagtttt 1801 ccgttgaaat tcaacgttta gcattcaaca ttggtgcttt gttctttgtt tctatcaaat 1861 cgaatcgatc aataatacag cttttgagtt ggcaaattgg taaatttgta aactaaggcc 1921 actgtaaatg aacaaataaa cattagttat ttatacttaa