Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140778 775 bp mRNA linear INV 09-DEC-2024 (LOC108056791), mRNA. ACCESSION XM_017140778 VERSION XM_017140778.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140778.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..775 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..775 /gene="LOC108056791" /note="uncharacterized LOC108056791; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056791" CDS 110..622 /gene="LOC108056791" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016996267.2" /db_xref="GeneID:108056791" /translation="MQPPRDMCKCLYNITRCVGQACSYSTKRNFLAMQAMTARKIRES NIPEKEAESRFDGNWGRGPQAGDRLPTAVSLVSCKLREAERNEVNTAFLRYGKSMTDL AKSARKLYKAARPRNIAPQQPMPGKIDTLRLGPLKKPEQNASAITDRLIKLFLQDPWD FPKNNGHSNE" polyA_site 775 /gene="LOC108056791" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgtgttttt agcagccagt ctagtaagat aaaaaaaaaa ctcacaaaat ttcatccagc 61 tacatagttt tcccaaattt tgtatttaaa tttttattga gagtaaacga tgcagccgcc 121 aagagatatg tgtaaatgtt tgtataatat aacgcgttgc gtgggtcaag cttgttccta 181 tagcaccaaa cgtaattttc tggccatgca ggccatgacc gcccgtaaga tccgggagtc 241 gaatatcccc gagaaggagg cggagtcccg ctttgatggc aactgggggc gtggccctca 301 agcgggcgac cgtctgccaa cggccgtgag tctggtcagt tgcaagctcc gggaggcgga 361 gaggaatgaa gtgaataccg ccttcctgcg ctatggaaaa tcaatgaccg atttggcgaa 421 gagtgcccgc aaattgtata aggctgcgcg acccaggaac atagctccac agcagccgat 481 gcccgggaaa atcgatacac ttcgcttggg acccttgaag aaaccggaac aaaatgcctc 541 cgccataacc gatcgtctta tcaagctgtt cttgcaagac ccctgggatt tccccaaaaa 601 taatgggcac tcaaacgaat aaggcttttc atggcttttc atatcgtctc gaggctttca 661 aatcgtcact tttggatctc atctaagcgg tagctttagt gcatttataa gaacgtgaat 721 aatgtttgta actttgtaac gttttttaaa ataaatgtct atagttacca gcaaa