Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial ribosomal protein


LOCUS       XM_017140747             935 bp    mRNA    linear   INV 09-DEC-2024
            L22 (mRpL22), mRNA.
ACCESSION   XM_017140747
VERSION     XM_017140747.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017140747.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..935
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..935
                     /gene="mRpL22"
                     /note="mitochondrial ribosomal protein L22; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108056772"
     CDS             103..792
                     /gene="mRpL22"
                     /codon_start=1
                     /product="large ribosomal subunit protein uL22m"
                     /protein_id="XP_016996236.1"
                     /db_xref="GeneID:108056772"
                     /translation="MHKVIRQMAQLRLQAPQGAALLRAGETPVTPAPATAPALQLQVK
                     SLHTGGLMCAKWNKHNYGPRKWLEYNKTVHPPQETDEEPRKAYVCHSRNNIKYSPDKM
                     WYIAAFVRGMSVDEALKQLNFVLKKGATDVKETILEAQQMAVERHNVEYKSNLWIAES
                     FVGKGRVFKGVRRHARGRFGRVEYKHCHYFVRLEEGEPPQHYYQEPQTPEQQYDHWLE
                     QMRSRKIINSL"
     misc_feature    370..684
                     /gene="mRpL22"
                     /note="Ribosomal protein L22p/L17e; Region: Ribosomal_L22;
                     pfam00237"
                     /db_xref="CDD:459725"
     polyA_site      935
                     /gene="mRpL22"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgatactcc agctggcaga ttacgcgacc gaacgagaag tctgcgtttt ccctttccaa
       61 ttaaaatagc ctggtttcct gtgataaagc ggcggactcg agatgcacaa ggtgatccgg
      121 cagatggccc agctgcgcct gcaggcgccg cagggagcag cgctcctcag agcgggcgaa
      181 accccagtca caccagcacc agcaactgca cctgccctcc agctccaagt gaagtccctg
      241 cacacgggag gattaatgtg cgccaagtgg aacaagcaca actacggacc aaggaagtgg
      301 ctggagtaca acaagacggt ccatccgccg caggaaacgg acgaggagcc caggaaggcg
      361 tacgtctgcc actcgcgcaa caacattaaa tacagcccgg acaagatgtg gtacatcgcc
      421 gccttcgttc gcggcatgtc cgtcgatgag gcactgaagc agctgaactt tgtgctcaag
      481 aagggagcca ccgatgtgaa ggagaccatc ctggaggccc agcaaatggc cgtggagcgg
      541 cacaatgtgg agtacaagag caatctgtgg atagccgaat cctttgtggg caagggacgc
      601 gtctttaagg gcgtgaggcg ccacgcccgc ggtcgcttcg gccgggtgga gtacaagcac
      661 tgtcactact tcgtccgatt ggaggagggc gagccgccgc agcactacta ccaggagcca
      721 cagacgccgg agcagcagta cgatcactgg ctggagcaga tgcgcagccg gaagatcatc
      781 aactcactgt agcccccaga aagcgcactt ccattgcacc ggtccgtact tttccaatcc
      841 tccaccatcg ccaccatcgc gtccacacat taagcatttt tttttgtttt tagaagattg
      901 tttaataaaa aaaaaacaaa agaaaatatt cacga