Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140747 935 bp mRNA linear INV 09-DEC-2024 L22 (mRpL22), mRNA. ACCESSION XM_017140747 VERSION XM_017140747.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017140747.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..935 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..935 /gene="mRpL22" /note="mitochondrial ribosomal protein L22; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108056772" CDS 103..792 /gene="mRpL22" /codon_start=1 /product="large ribosomal subunit protein uL22m" /protein_id="XP_016996236.1" /db_xref="GeneID:108056772" /translation="MHKVIRQMAQLRLQAPQGAALLRAGETPVTPAPATAPALQLQVK SLHTGGLMCAKWNKHNYGPRKWLEYNKTVHPPQETDEEPRKAYVCHSRNNIKYSPDKM WYIAAFVRGMSVDEALKQLNFVLKKGATDVKETILEAQQMAVERHNVEYKSNLWIAES FVGKGRVFKGVRRHARGRFGRVEYKHCHYFVRLEEGEPPQHYYQEPQTPEQQYDHWLE QMRSRKIINSL" misc_feature 370..684 /gene="mRpL22" /note="Ribosomal protein L22p/L17e; Region: Ribosomal_L22; pfam00237" /db_xref="CDD:459725" polyA_site 935 /gene="mRpL22" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcgatactcc agctggcaga ttacgcgacc gaacgagaag tctgcgtttt ccctttccaa 61 ttaaaatagc ctggtttcct gtgataaagc ggcggactcg agatgcacaa ggtgatccgg 121 cagatggccc agctgcgcct gcaggcgccg cagggagcag cgctcctcag agcgggcgaa 181 accccagtca caccagcacc agcaactgca cctgccctcc agctccaagt gaagtccctg 241 cacacgggag gattaatgtg cgccaagtgg aacaagcaca actacggacc aaggaagtgg 301 ctggagtaca acaagacggt ccatccgccg caggaaacgg acgaggagcc caggaaggcg 361 tacgtctgcc actcgcgcaa caacattaaa tacagcccgg acaagatgtg gtacatcgcc 421 gccttcgttc gcggcatgtc cgtcgatgag gcactgaagc agctgaactt tgtgctcaag 481 aagggagcca ccgatgtgaa ggagaccatc ctggaggccc agcaaatggc cgtggagcgg 541 cacaatgtgg agtacaagag caatctgtgg atagccgaat cctttgtggg caagggacgc 601 gtctttaagg gcgtgaggcg ccacgcccgc ggtcgcttcg gccgggtgga gtacaagcac 661 tgtcactact tcgtccgatt ggaggagggc gagccgccgc agcactacta ccaggagcca 721 cagacgccgg agcagcagta cgatcactgg ctggagcaga tgcgcagccg gaagatcatc 781 aactcactgt agcccccaga aagcgcactt ccattgcacc ggtccgtact tttccaatcc 841 tccaccatcg ccaccatcgc gtccacacat taagcatttt tttttgtttt tagaagattg 901 tttaataaaa aaaaaacaaa agaaaatatt cacga