Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140745 976 bp mRNA linear INV 09-DEC-2024 (LOC108056771), mRNA. ACCESSION XM_017140745 VERSION XM_017140745.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140745.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..976 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..976 /gene="LOC108056771" /note="neuferricin homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056771" CDS 33..896 /gene="LOC108056771" /codon_start=1 /product="neuferricin homolog" /protein_id="XP_016996234.2" /db_xref="GeneID:108056771" /translation="MFGLLRHLFKLQFLFVVAAILAGFYQTEIRQFLRRQTDDYLDQA GQDAGIPLAFSADDEVGTVFTPAELARFNGEEEGRPLYLALLGSVFDVSRGIKHYGSG CSYNFFVGRDASVSFISGDFETYDPETSDDVLSLKPEDLIGLAGWRDFYQKDYVYKGR LVGRFYDAKGAPTSYHHKFLELLQQARDAKRQVEELRARYPGCNIEWSQERGTRVWCT NTSGDGKERSWIGHPRKLYSRGNKSFQCACVPDSQLDEIDAGGQAAHGDAMLKPYDNC EPRALECFYRV" misc_feature 225..461 /gene="LOC108056771" /note="Cytochrome b5-like Heme/Steroid binding domain; Region: Cyt-b5; pfam00173" /db_xref="CDD:459698" polyA_site 976 /gene="LOC108056771" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tccggttccg atccgctgtg ggaaattaca agatgtttgg attgctgcga cacctgttca 61 aattgcagtt tctctttgtt gtggccgcca ttctggccgg attctaccag acggagatta 121 ggcagttcct gcgccggcag acggacgact acctggacca ggctggccag gatgcgggca 181 ttccgctggc cttttcagcc gatgacgaag tcggcacggt attcacgccg gccgagttgg 241 cccggttcaa tggcgaggag gagggccgac cgctctacct ggccctgctg ggatccgtct 301 tcgatgtgag ccgcgggatc aagcactacg gctccgggtg cagctacaac ttcttcgtgg 361 gacgcgacgc ctcggtgtcc ttcatttccg gcgacttcga gacctacgac ccggaaacat 421 ccgacgatgt gctctcgctg aagccggagg atctgatagg actggccggg tggcgggact 481 tctaccagaa ggactacgtc tacaagggtc ggctggtggg gcgcttctac gatgcgaagg 541 gagccccgac gagctatcac cacaagttcc tggagctgct gcagcaggcg cgggatgcga 601 agcggcaggt ggaggagctg cgggcccgct atcccggttg caatatcgag tggagccagg 661 agcggggcac ccgcgtctgg tgcaccaaca ccagcggcga tgggaaggag cgctcctgga 721 tcggccatcc ccgcaagctc tacagtcgcg gcaacaagag cttccagtgc gcctgtgtgc 781 ccgattccca gctggacgag atcgatgccg gcggccaggc ggcccacgga gacgccatgc 841 tgaagcccta cgacaactgc gaaccccgcg ccctggagtg cttctatagg gtgtagcagc 901 tggccctgga tttgtaaata tctagcacat tccggacgaa agtaataaac agattatcag 961 ttttaagtta acatga