Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii neuferricin homolog


LOCUS       XM_017140745             976 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056771), mRNA.
ACCESSION   XM_017140745
VERSION     XM_017140745.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140745.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..976
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..976
                     /gene="LOC108056771"
                     /note="neuferricin homolog; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056771"
     CDS             33..896
                     /gene="LOC108056771"
                     /codon_start=1
                     /product="neuferricin homolog"
                     /protein_id="XP_016996234.2"
                     /db_xref="GeneID:108056771"
                     /translation="MFGLLRHLFKLQFLFVVAAILAGFYQTEIRQFLRRQTDDYLDQA
                     GQDAGIPLAFSADDEVGTVFTPAELARFNGEEEGRPLYLALLGSVFDVSRGIKHYGSG
                     CSYNFFVGRDASVSFISGDFETYDPETSDDVLSLKPEDLIGLAGWRDFYQKDYVYKGR
                     LVGRFYDAKGAPTSYHHKFLELLQQARDAKRQVEELRARYPGCNIEWSQERGTRVWCT
                     NTSGDGKERSWIGHPRKLYSRGNKSFQCACVPDSQLDEIDAGGQAAHGDAMLKPYDNC
                     EPRALECFYRV"
     misc_feature    225..461
                     /gene="LOC108056771"
                     /note="Cytochrome b5-like Heme/Steroid binding domain;
                     Region: Cyt-b5; pfam00173"
                     /db_xref="CDD:459698"
     polyA_site      976
                     /gene="LOC108056771"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tccggttccg atccgctgtg ggaaattaca agatgtttgg attgctgcga cacctgttca
       61 aattgcagtt tctctttgtt gtggccgcca ttctggccgg attctaccag acggagatta
      121 ggcagttcct gcgccggcag acggacgact acctggacca ggctggccag gatgcgggca
      181 ttccgctggc cttttcagcc gatgacgaag tcggcacggt attcacgccg gccgagttgg
      241 cccggttcaa tggcgaggag gagggccgac cgctctacct ggccctgctg ggatccgtct
      301 tcgatgtgag ccgcgggatc aagcactacg gctccgggtg cagctacaac ttcttcgtgg
      361 gacgcgacgc ctcggtgtcc ttcatttccg gcgacttcga gacctacgac ccggaaacat
      421 ccgacgatgt gctctcgctg aagccggagg atctgatagg actggccggg tggcgggact
      481 tctaccagaa ggactacgtc tacaagggtc ggctggtggg gcgcttctac gatgcgaagg
      541 gagccccgac gagctatcac cacaagttcc tggagctgct gcagcaggcg cgggatgcga
      601 agcggcaggt ggaggagctg cgggcccgct atcccggttg caatatcgag tggagccagg
      661 agcggggcac ccgcgtctgg tgcaccaaca ccagcggcga tgggaaggag cgctcctgga
      721 tcggccatcc ccgcaagctc tacagtcgcg gcaacaagag cttccagtgc gcctgtgtgc
      781 ccgattccca gctggacgag atcgatgccg gcggccaggc ggcccacgga gacgccatgc
      841 tgaagcccta cgacaactgc gaaccccgcg ccctggagtg cttctatagg gtgtagcagc
      901 tggccctgga tttgtaaata tctagcacat tccggacgaa agtaataaac agattatcag
      961 ttttaagtta acatga