Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017140740             739 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056766), mRNA.
ACCESSION   XM_017140740
VERSION     XM_017140740.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140740.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..739
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..739
                     /gene="LOC108056766"
                     /note="uncharacterized LOC108056766; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056766"
     CDS             221..586
                     /gene="LOC108056766"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_016996229.1"
                     /db_xref="GeneID:108056766"
                     /translation="MLRMQSAMRSAARQTQKLMRMMCYDSQRIKAQFLVQNGESPANA
                     EELDTQDKEGSEQTPAAVPRPRTPLHNPLSRRHTVNSSRLQYINDKYKELANEVELRK
                     PKEKPFVTRHALHSGRFDK"
     polyA_site      739
                     /gene="LOC108056766"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccaggcaggc atttcatttc attccatttc acatttcacc gtgcactttt tacttttcgg
       61 gcaaactcat tttttacaca gaaaaatcgc tcgcaacttc gctggcaagg gaatagaaaa
      121 tcaacccaaa accgagaatc tatccagccg accgaatata ttttccacgc acacataaat
      181 ccaaaatctt aaaggcagct cgcctttcga atttcccaga atgcttagga tgcaatccgc
      241 gatgagatct gctgcccggc agacccaaaa gctaatgcga atgatgtgct atgattcgca
      301 acgcattaag gcgcagtttc tggtccaaaa tggggaatcc cctgccaatg cagaggaact
      361 cgatactcag gataaggagg ggtcagaaca gaccccggcg gcggtgccac gcccccgcac
      421 gcccctccac aatccgttga gtcgacgcca cactgtgaac agttcccgac tgcagtacat
      481 caacgacaag tacaaggagc tggccaacga ggtggagttg cgcaagccca aggaaaagcc
      541 cttcgtgacc cgccacgccc tccattcggg gcggttcgac aagtgacacg atcttgagat
      601 cttataaacc ttataaatta gtgatccaga aactcacact cacttcttgt tcaacgtatt
      661 tcgcctgtta aatcacaaag taaaatgctg tacataaaat gcataaaaat taaatttaat
      721 ttaaatcaat tgaagcaga