Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140738 991 bp mRNA linear INV 09-DEC-2024 (LOC108056765), mRNA. ACCESSION XM_017140738 VERSION XM_017140738.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140738.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..991 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..991 /gene="LOC108056765" /note="uncharacterized LOC108056765; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056765" CDS 156..971 /gene="LOC108056765" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_016996227.2" /db_xref="GeneID:108056765" /translation="MRSIILVLALAVAAVSAVPLIEDQDATALKELFKKMNLDLDLNL NFDLDLGVNLDEVMELELELPEEGTTDVAVDEFAFLDRVVRLLLSEAKALGRQIIRLT ERQLLKIFLYPLRELEKLAEELEQKALDAGDCALNVTTSVADVLAWGTVGYTRCAYDA ACTSIDLVVDTKKAVLQLTLDAYHIYTKRRECKTKTLAITKKTCEAGLYLQCISFVAK APGSILHLIGLRNSVPAVATDATSCTNEATENVLRGFNELNEAIDACAANFKK" ORIGIN 1 taatgggaaa taaatcaatt ggccgataaa cgactcttga atattttaat taactggggg 61 tacggctact gccaccgata tggcaatctg gatctgggct ttgggtcgta tataaggtgg 121 atccccagcg agatcccagc aaaacccaat caaccatgag gagtattatt ctagtgttgg 181 ccttggccgt ggcagctgtt tcagcggtgc ccctaataga ggaccaggat gcgaccgccc 241 tgaaggaatt gttcaagaaa atgaaccttg acttggactt gaacttgaac ttcgacctgg 301 acctgggagt caacttggac gaggtgatgg aactggaact ggaactgccc gaggagggca 361 ccaccgacgt ggcggtggat gagttcgcct ttttggaccg ggtggtgcgc ctcctgcttt 421 cggaggcgaa ggccctggga cgccaaatca tccggctgac cgagcgccag ctgctgaaga 481 tcttccttta tccgctgagg gagctggaga agctggccga ggagctcgag cagaaggctt 541 tggatgcggg cgactgcgcg ctcaatgtga ccaccagtgt ggccgatgtc ctggcctggg 601 gcaccgtggg ctacacgaga tgcgcctacg atgccgcctg cacctccatc gatctggtcg 661 tggacaccaa gaaggcggtc ctccagttga ccctggacgc ctatcacatc tacacgaaga 721 ggcgcgagtg caagaccaag acacttgcga ttacaaaaaa gacctgcgaa gcgggcttgt 781 atctccaatg tatttcgttc gtcgccaagg ccccgggctc catactccat ttgattggac 841 tccggaacag cgtgcccgcc gtggccaccg atgccacctc ctgcaccaac gaggccaccg 901 agaacgtcct ccggggattc aacgagctca acgaagccat tgacgcctgt gccgccaact 961 ttaagaagtg aaaaaattaa ataaattgta t