Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140737 1129 bp mRNA linear INV 09-DEC-2024 regulator of actin dynamics (LOC108056764), mRNA. ACCESSION XM_017140737 VERSION XM_017140737.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140737.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1129 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1129 /gene="LOC108056764" /note="capping protein-inhibiting regulator of actin dynamics; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108056764" CDS 254..1072 /gene="LOC108056764" /codon_start=1 /product="capping protein-inhibiting regulator of actin dynamics" /protein_id="XP_016996226.2" /db_xref="GeneID:108056764" /translation="MQRSVFKSTFLILLKRSFHLESSAPVAAKSSCLDLLGRLLQGRL NLLGGRPVPFRFLPIFKGDNRSLYFNADEDEEFRRRLAMQLKELREALQETQELRERQ EDELQEELQLREQEEEEYHPYTTRSREISAEDLSEEELNEMRKLRMSSAGQDGRDQEG STSGSSEQETSELEGEETAAEAREPQDPQEFEVREVREGDIEGVYWTGEGKRIVTQTP QRKTGHSGFIDGEGEEIPLEELPHHREDPSSSPPAPRAQDEGSRKSPSASDSDE" polyA_site 1129 /gene="LOC108056764" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atttcatcag tcgttagccg gccaccgact cctaaacaac aaactaaaat tctatagttt 61 ttaaattttt ttcgtctaaa aatcaagaaa ccaaaatttc tcaaaaaaat acatctgcaa 121 tagaaaaatt ctgaaaagca taaagaaatc ggcaaggctc tcagttctta caaaaccaaa 181 aaaaaaatta aaaaagtaaa accgcgcgga aaacccatat aacaaatata tcactgtaaa 241 atctagaaaa aaaatgcaac gttcggtttt caagagcacc tttctgatcc tgctgaaaag 301 gtccttccac ctggagtctt cggctcctgt tgctgccaaa agtagctgcc tggatctctt 361 gggtcgcctg ctccaagggc gattgaacct tttgggaggt cgtcctgttc cctttagatt 421 tctgcccatc ttcaagggcg acaatcgcag tctgtacttc aatgccgatg aggacgagga 481 gttccgccgt cgcctggcca tgcagctgaa ggagctgcgc gaggcgctgc aggaaacgca 541 ggagctgcgg gagagacagg aggacgaact gcaggaggag ctgcagctgc gggagcagga 601 ggaggaggag tatcatccgt atacgacaag gtcgcgggag atttccgcgg aggatctgag 661 cgaagaggag ctgaacgaga tgcgcaagct gcggatgagt tccgctggcc aggatggtcg 721 ggatcaggag ggatccacca gtggtagctc ggagcaggaa accagtgaac tagaaggcga 781 ggagaccgca gcggaggcca gggagccgca ggatcctcaa gaattcgagg ttcgagaggt 841 tcgcgagggc gacatcgagg gcgtctactg gacgggcgag ggcaagcgga tagtgaccca 901 aaccccacag cggaagacgg gacactcggg ctttatcgac ggcgagggcg aggagatacc 961 cctggaggag ctgccccatc atcgggagga tccttcctcc tctccgccag cgcctcgggc 1021 acaggacgag ggaagccgca aatcgccgtc ggccagcgat tccgatgaat agctaaattg 1081 ccattcgacg agcaaaccct ctaaaataaa tacaaaaggc taaagacaa