Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii protein KTI12 homolog


LOCUS       XM_017140732            1124 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108056761), mRNA.
ACCESSION   XM_017140732
VERSION     XM_017140732.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140732.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1124
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1124
                     /gene="LOC108056761"
                     /note="protein KTI12 homolog; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108056761"
     CDS             84..959
                     /gene="LOC108056761"
                     /codon_start=1
                     /product="protein KTI12 homolog"
                     /protein_id="XP_016996221.2"
                     /db_xref="GeneID:108056761"
                     /translation="MPIVVVTGLPASGKSTRARQLRDHFVERGRKVHLISENEAVPKA
                     LFGKNSHAADSQKEKVVRSDLKSEASRHLNKEDVVILDAGNYIKGYRYELYCMTKASR
                     TTQCTLFCCIPQEQAWRFNGQRTAPDELVADNSDVAYSRETFDALCMRYEEPQSNNRW
                     DSPLVVALPEDTLDVEAIYKALYETQPLPPNQSTQNPPLGATNYLFELDNIMQAIIKE
                     ILGAVKIKAFGQLRIPGSSCPVKVATSMSALQLNRLRQKFITSTCRASQTAPTPLEQV
                     PSLFVQFINANTIGC"
     misc_feature    93..938
                     /gene="LOC108056761"
                     /note="Chromatin associated protein KTI12; Region: KTI12;
                     pfam08433"
                     /db_xref="CDD:400643"
ORIGIN      
        1 cgcacttagc caacactgcc tccaatcgtg gacgaccgga ctgtttttat tttgtttatt
       61 tattgctttg accaggataa ggaatgccga ttgtggtcgt caccggtctg ccggccagcg
      121 ggaagtccac ccgggcccgc cagctgcggg atcacttcgt ggagcgcggg aggaaggtgc
      181 atttgatcag cgagaacgag gcggtgccga aggcgctctt tggcaagaat tcgcatgccg
      241 cggattcgca gaaggagaag gtggtgcgca gcgatctcaa gtcggaggcc tcgcgacacc
      301 tcaacaagga ggatgtggtc atcctggacg cgggcaacta catcaagggc tatcgctacg
      361 aactgtactg catgaccaag gcgtccagga cgacgcagtg cacgctgttc tgctgcattc
      421 cccaggagca ggcgtggcgc ttcaatggcc agcgaacggc gccggatgag ctggtggcgg
      481 acaactcgga tgtggcctac agccgcgaga ccttcgatgc cctgtgcatg cgctacgagg
      541 agccgcagag caacaaccgc tgggacagcc ccctggtggt cgccctgccc gaggacacgc
      601 tcgatgtgga ggccatctac aaggccctct acgagacgca gcccctgccg cccaaccaga
      661 gcacccagaa tccaccgctg ggggccacca actatctgtt cgaactggac aacatcatgc
      721 aggcgatcat caaggagatc cttggagcgg tcaagatcaa ggccttcggc cagctgcgca
      781 tccccggcag cagttgtccc gtcaaggtgg ccacctcgat gagcgccctc cagctgaacc
      841 gcctgcgcca gaagttcatc acgagcacgt gccgcgccag ccagacggcg cccactccgc
      901 tggagcaggt gccctcgctg ttcgtccagt tcatcaatgc caacaccatc ggctgctaaa
      961 taatagtata caaaactgta taaaaaagtt aaaggttata agaaaaagaa ctaaaaaata
     1021 tatagcttga ataataacac tttgtaattg tccatatttt cattgatgtt tgtcggattt
     1081 ggttgattta gaataaagga tttgttttat tttgctatta actt