Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140718 1417 bp mRNA linear INV 09-DEC-2024 LE (PGRP-LE), mRNA. ACCESSION XM_017140718 VERSION XM_017140718.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140718.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1417 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1417 /gene="PGRP-LE" /note="Peptidoglycan recognition protein LE; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:108056748" CDS 283..1326 /gene="PGRP-LE" /codon_start=1 /product="peptidoglycan-recognition protein LE" /protein_id="XP_016996207.2" /db_xref="GeneID:108056748" /translation="MSESGIKKLSQERTREWLASQEDEELESIAESSVVDSLDYDYTE EEEDTDQNTSEEISTMTLGTQISARKRSIISDTIRDLMNSINSIQTLGNVNISNSTNV HIGNVTNINGNIQIIADSLSQNRRDRDRRNVSPPKDSAPRPETHFDEDYQDEAEERVR SDVFIRRQKFKIPKELCSIIPRHSWLAQKPMEDPQPLQLPVKYVVILHTATESSEKRA INVRLIRDMQCFHIESRGWNDIAYNFLIGCDGNIYEGRGWQTVGAHTLGYNKISLGIG FIGCFMRELPTTDALNMCRNLLARGVEDGHISADYRLICHCQCNSTESPGRQLYEEIQ TWPHFYNIEEEEQ" misc_feature 811..1239 /gene="PGRP-LE" /note="Animal peptidoglycan recognition proteins homologous to Bacteriophage T3 lysozyme; Region: PGRP; smart00701" /db_xref="CDD:128941" misc_feature order(901..903,1006..1008,1228..1230,1246..1248, 1252..1254) /gene="PGRP-LE" /note="amidase catalytic site [active]" /db_xref="CDD:133475" misc_feature order(901..903,1228..1230,1252..1254) /gene="PGRP-LE" /note="Zn binding residues [ion binding]; other site" /db_xref="CDD:133475" misc_feature order(904..909,994..996,1006..1008,1048..1050,1069..1074, 1087..1089,1228..1230,1246..1254) /gene="PGRP-LE" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:133475" polyA_site 1417 /gene="PGRP-LE" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcgataattt aaacaataat taatatatat gactaaattt gcaataaaaa aaaccccagc 61 acgcctaata tccaataaag tatttcacca tagcacccaa gaatataatg gtggatagcc 121 aaagggagcg tccttatctt atcgggagag gtggacacga gacgaccaac taatcagggt 181 atagagtagt gctagctaac aatattgata aacaaagtag aggccagccg agagttacac 241 gcgcatttta ttggccagtg aagaggagcc aatactacgg atatgtccga atcgggaatc 301 aagaagctga gtcaggagcg gactcgcgaa tggctggcca gccaggagga cgaggagctg 361 gagtccatag ccgagtcctc ggtggtggat agcttagact atgactacac ggaggaggag 421 gaggataccg atcagaatac gagcgaggag atcagcacca tgacactagg cactcagatc 481 tctgcgcgaa aacgctccat catcagcgac accatcaggg acctcatgaa ctcgatcaac 541 agcattcaga ctttgggcaa cgtgaacatc agcaactcca cgaacgtcca catcggcaat 601 gtgaccaata tcaatggaaa tatacaaatc atagccgata gccttagcca aaaccgcaga 661 gatagggatc ggcgaaacgt atcgcccccg aaagatagcg ctcccaggcc ggagacacat 721 ttcgatgagg attatcagga cgaggcggag gagagggtgc gctccgatgt gtttatcagg 781 cgtcaaaagt tcaaaatacc caaggagctg tgctccatta ttccacgaca ctcctggctg 841 gcacaaaagc ccatggagga tccgcagccc ttgcagctcc ccgttaaata tgtggttatt 901 ttacacacgg ctaccgagag ctcagagaaa cgtgcgatca acgtaagact tatccgtgat 961 atgcagtgct tccacatcga gtcgcgtgga tggaatgaca ttgcgtacaa ctttctgatc 1021 ggctgtgacg gcaacatcta cgagggacgc ggctggcaga cggtgggtgc ccatacactg 1081 ggctacaaca agatatcgct gggcatcggg ttcataggat gcttcatgcg agaactgccc 1141 acaacggacg cactgaacat gtgccgcaac ctcttggccc gcggcgtgga agatggacac 1201 atatctgcgg actacagact tatttgccac tgccagtgca attcaacgga aagtccaggc 1261 cgccaactgt acgaagagat acagacgtgg cctcactttt acaatatcga ggaggaggag 1321 caatagagga caaagaaatc accctattta catatgagtt aaatgcaccc gagttaagtt 1381 tacatcattg ttgaacatta aatcacacgt ttataaa