Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Peptidoglycan recognition protein


LOCUS       XM_017140718            1417 bp    mRNA    linear   INV 09-DEC-2024
            LE (PGRP-LE), mRNA.
ACCESSION   XM_017140718
VERSION     XM_017140718.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140718.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1417
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1417
                     /gene="PGRP-LE"
                     /note="Peptidoglycan recognition protein LE; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 13 Proteins"
                     /db_xref="GeneID:108056748"
     CDS             283..1326
                     /gene="PGRP-LE"
                     /codon_start=1
                     /product="peptidoglycan-recognition protein LE"
                     /protein_id="XP_016996207.2"
                     /db_xref="GeneID:108056748"
                     /translation="MSESGIKKLSQERTREWLASQEDEELESIAESSVVDSLDYDYTE
                     EEEDTDQNTSEEISTMTLGTQISARKRSIISDTIRDLMNSINSIQTLGNVNISNSTNV
                     HIGNVTNINGNIQIIADSLSQNRRDRDRRNVSPPKDSAPRPETHFDEDYQDEAEERVR
                     SDVFIRRQKFKIPKELCSIIPRHSWLAQKPMEDPQPLQLPVKYVVILHTATESSEKRA
                     INVRLIRDMQCFHIESRGWNDIAYNFLIGCDGNIYEGRGWQTVGAHTLGYNKISLGIG
                     FIGCFMRELPTTDALNMCRNLLARGVEDGHISADYRLICHCQCNSTESPGRQLYEEIQ
                     TWPHFYNIEEEEQ"
     misc_feature    811..1239
                     /gene="PGRP-LE"
                     /note="Animal peptidoglycan recognition proteins
                     homologous to Bacteriophage T3 lysozyme; Region: PGRP;
                     smart00701"
                     /db_xref="CDD:128941"
     misc_feature    order(901..903,1006..1008,1228..1230,1246..1248,
                     1252..1254)
                     /gene="PGRP-LE"
                     /note="amidase catalytic site [active]"
                     /db_xref="CDD:133475"
     misc_feature    order(901..903,1228..1230,1252..1254)
                     /gene="PGRP-LE"
                     /note="Zn binding residues [ion binding]; other site"
                     /db_xref="CDD:133475"
     misc_feature    order(904..909,994..996,1006..1008,1048..1050,1069..1074,
                     1087..1089,1228..1230,1246..1254)
                     /gene="PGRP-LE"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133475"
     polyA_site      1417
                     /gene="PGRP-LE"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgataattt aaacaataat taatatatat gactaaattt gcaataaaaa aaaccccagc
       61 acgcctaata tccaataaag tatttcacca tagcacccaa gaatataatg gtggatagcc
      121 aaagggagcg tccttatctt atcgggagag gtggacacga gacgaccaac taatcagggt
      181 atagagtagt gctagctaac aatattgata aacaaagtag aggccagccg agagttacac
      241 gcgcatttta ttggccagtg aagaggagcc aatactacgg atatgtccga atcgggaatc
      301 aagaagctga gtcaggagcg gactcgcgaa tggctggcca gccaggagga cgaggagctg
      361 gagtccatag ccgagtcctc ggtggtggat agcttagact atgactacac ggaggaggag
      421 gaggataccg atcagaatac gagcgaggag atcagcacca tgacactagg cactcagatc
      481 tctgcgcgaa aacgctccat catcagcgac accatcaggg acctcatgaa ctcgatcaac
      541 agcattcaga ctttgggcaa cgtgaacatc agcaactcca cgaacgtcca catcggcaat
      601 gtgaccaata tcaatggaaa tatacaaatc atagccgata gccttagcca aaaccgcaga
      661 gatagggatc ggcgaaacgt atcgcccccg aaagatagcg ctcccaggcc ggagacacat
      721 ttcgatgagg attatcagga cgaggcggag gagagggtgc gctccgatgt gtttatcagg
      781 cgtcaaaagt tcaaaatacc caaggagctg tgctccatta ttccacgaca ctcctggctg
      841 gcacaaaagc ccatggagga tccgcagccc ttgcagctcc ccgttaaata tgtggttatt
      901 ttacacacgg ctaccgagag ctcagagaaa cgtgcgatca acgtaagact tatccgtgat
      961 atgcagtgct tccacatcga gtcgcgtgga tggaatgaca ttgcgtacaa ctttctgatc
     1021 ggctgtgacg gcaacatcta cgagggacgc ggctggcaga cggtgggtgc ccatacactg
     1081 ggctacaaca agatatcgct gggcatcggg ttcataggat gcttcatgcg agaactgccc
     1141 acaacggacg cactgaacat gtgccgcaac ctcttggccc gcggcgtgga agatggacac
     1201 atatctgcgg actacagact tatttgccac tgccagtgca attcaacgga aagtccaggc
     1261 cgccaactgt acgaagagat acagacgtgg cctcactttt acaatatcga ggaggaggag
     1321 caatagagga caaagaaatc accctattta catatgagtt aaatgcaccc gagttaagtt
     1381 tacatcattg ttgaacatta aatcacacgt ttataaa