Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii stunted (sun), transcript variant


LOCUS       XM_017140696             454 bp    mRNA    linear   INV 09-DEC-2024
            X2, mRNA.
ACCESSION   XM_017140696
VERSION     XM_017140696.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017140696.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..454
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..454
                     /gene="sun"
                     /note="stunted; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108056738"
     CDS             117..290
                     /gene="sun"
                     /codon_start=1
                     /product="protein stunted isoform X2"
                     /protein_id="XP_016996185.1"
                     /db_xref="GeneID:108056738"
                     /translation="MTAWRAAGITYIQYSNIAARILRESLKAPLRTDAAKRDASHVKF
                     TPWANGKPAHERA"
     misc_feature    120..266
                     /gene="sun"
                     /note="Mitochondrial ATP synthase epsilon chain; Region:
                     ATP-synt_Eps; pfam04627"
                     /db_xref="CDD:461373"
     misc_feature    order(126..131,141..152,159..164,174..176,225..257)
                     /gene="sun"
                     /note="gamma subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213396"
     misc_feature    order(147..149,156..173,186..197,204..206,225..227)
                     /gene="sun"
                     /note="delta subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213396"
     polyA_site      454
                     /gene="sun"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccagtcattt ctggtatttt tggtccacca acctgcggtc acacttgtcc ggaatccgaa
       61 attaagaatt cttaattttt gcgtagcgtg aatatatttc gaataatccg atcacaatga
      121 ctgcctggag agctgccgga attacctaca tccaatattc caacatcgcc gctcgcattt
      181 tgcgcgagtc cttgaaggcg cctctgcgta ccgatgccgc caagcgcgac gcgagtcatg
      241 tgaaattcac tccctgggca aatggcaagc cagcacatga aagggcctaa gtgttctgtc
      301 gacaattaaa taagttaaaa actgtcagcg ccaaaccacc caatcggaat cctagacgct
      361 tcgcagtggc cccttagaat gatttgcaac aaataacatc tgtagaatca tcgaagatga
      421 aaataattta aataaatttg aattattcaa acaa