Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017140695 404 bp mRNA linear INV 09-DEC-2024 X1, mRNA. ACCESSION XM_017140695 VERSION XM_017140695.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017140695.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..404 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..404 /gene="sun" /note="stunted; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108056738" CDS 117..305 /gene="sun" /codon_start=1 /product="protein stunted isoform X1" /protein_id="XP_016996184.1" /db_xref="GeneID:108056738" /translation="MTAWRAAGITYIQYSNIAARILRESLKAPLRTDAAKRDASHVKF TPWANGKPAQRQTTQSES" misc_feature 120..266 /gene="sun" /note="Mitochondrial ATP synthase epsilon chain; Region: ATP-synt_Eps; pfam04627" /db_xref="CDD:461373" misc_feature order(126..131,141..152,159..164,174..176,225..257) /gene="sun" /note="gamma subunit interface [polypeptide binding]; other site" /db_xref="CDD:213396" misc_feature order(147..149,156..173,186..197,204..206,225..227) /gene="sun" /note="delta subunit interface [polypeptide binding]; other site" /db_xref="CDD:213396" polyA_site 404 /gene="sun" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccagtcattt ctggtatttt tggtccacca acctgcggtc acacttgtcc ggaatccgaa 61 attaagaatt cttaattttt gcgtagcgtg aatatatttc gaataatccg atcacaatga 121 ctgcctggag agctgccgga attacctaca tccaatattc caacatcgcc gctcgcattt 181 tgcgcgagtc cttgaaggcg cctctgcgta ccgatgccgc caagcgcgac gcgagtcatg 241 tgaaattcac tccctgggca aatggcaagc cagcacagcg ccaaaccacc caatcggaat 301 cctagacgct tcgcagtggc cccttagaat gatttgcaac aaataacatc tgtagaatca 361 tcgaagatga aaataattta aataaatttg aattattcaa acaa